Detailed description page of THPdb

This page displays user query in tabular form.

Th1014 details

Primary information
ID 1098
ThPP ID Th1014
Therapeutic Peptide/Protein Name Salmon Calcitonin
Sequence CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP view full sequnce in fasta
Functional Classification Ib
Molecular Weight 3431.853
Chemical Formula C145H240N44O48S2
Isoelectric Point 8.86
Hydrophobicity -0.537
Melting Point (℃) N.A.
Half Life 0.83-1.33 hours
Description Synthetic peptide of 32 residues, formulated as a nasal spray.
Indication/Disease Used for the treatment of post-menopausal osteoporosis.
Pharmacodynamics Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney.
Mechanism of Action Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway.
Toxicity It is devoid of embryotoxic, teratogenic and mutagenic potential.
Metabolism Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule.
Absorption Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively).
Volume of Distribution N.A.
Clearance Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney.
Categories Bone Density Conservation Agents
Patents Number US6440392
Date of Issue 02/02/01
Date of Expiry 02/02/21
Drug Interaction Eskalith (lithium)
Target Calcitonin receptor
Information of corresponding available drug in the market
Brand Name Calcimar
Company N.A.
Brand Discription Calcitonin is a group of polypeptide hormones secreted by the thyroid gland in mammals and by the ultimobranchial gland of birds and fish. It is of physiological importance in the regulation of calcium metabolism in certain animal species, and may also ha
Prescribed for To treat Paget's disease of bone
Chemical Name N.A.
Formulation Each mL of sterile solution contains calcitonin salmon 200 IU. Nonmedicinal ingredients include acetic acid, phenol, sodium acetate, sodium chloride, sodium hydroxide and water for injection.
Physcial Appearance Solution
Route of Administration Subcutaneous or intramuSubcutaneousular Injection
Recommended Dosage Based on body weight and injected every 12 hours
Contraindication Allergy
Side Effects Feeling light-headed, fainting; or muscle stiffness.
Useful Link http://www.drugs.com/sfx/calcimar-side-effects.html
PubMed ID 25860966, 24708057, 24357414, 24252061, 22001608, 20946924, 18704953, 18023905, 17207880
3-D Structure Th1014 (View) or (Download)

Primary information
ID 1099
ThPP ID Th1014
Therapeutic Peptide/Protein Name Salmon Calcitonin
Sequence CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP view full sequnce in fasta
Functional Classification Ib
Molecular Weight 3431.853
Chemical Formula C145H240N44O48S2
Isoelectric Point 8.86
Hydrophobicity -0.537
Melting Point (℃) N.A.
Half Life 0.83-1.33 hours
Description Synthetic peptide of 32 residues, formulated as a nasal spray.
Indication/Disease Used for the treatment of post-menopausal osteoporosis.
Pharmacodynamics Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney.
Mechanism of Action Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway.
Toxicity It is devoid of embryotoxic, teratogenic and mutagenic potential.
Metabolism Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule.
Absorption Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively).
Volume of Distribution N.A.
Clearance Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney.
Categories Antihypercalcemic Agents
Patents Number US5733569
Date of Issue 31/03/95
Date of Expiry 31/03/15
Drug Interaction Eskalith-CR (lithium)
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for For treatment of postmenopausal osteoporosis
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Swelling in your feet
Useful Link http://www.drugs.com/drug-interactions/calcitonin-index.html?filter=1
PubMed ID 25860966, 24708057, 24357414, 24252061, 22001608, 20946924, 18704953, 18023905, 17207880
3-D Structure Th1014 (View) or (Download)

Primary information
ID 1100
ThPP ID Th1014
Therapeutic Peptide/Protein Name Salmon Calcitonin
Sequence CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP view full sequnce in fasta
Functional Classification Ib
Molecular Weight 3431.853
Chemical Formula C145H240N44O48S2
Isoelectric Point 8.86
Hydrophobicity -0.537
Melting Point (℃) N.A.
Half Life 0.83-1.33 hours
Description Synthetic peptide of 32 residues, formulated as a nasal spray.
Indication/Disease Used for the treatment of post-menopausal osteoporosis.
Pharmacodynamics Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney.
Mechanism of Action Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway.
Toxicity It is devoid of embryotoxic, teratogenic and mutagenic potential.
Metabolism Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule.
Absorption Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively).
Volume of Distribution N.A.
Clearance Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney.
Categories Anti-Osteporotic Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Foscavir (foscarnet)
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for To reduce high levels of calcium in the blood (hypercalcemia)
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Swelling or irritation of the skin where an injection was given.
Useful Link http://www.rxmed.com/b.main/b2.pharmaceutical/b2.1.monographs/CPS-%20Monographs/CPS-%20%28General%20Monographs-%20C%29/CALCIMAR.html
PubMed ID 25860966, 24708057, 24357414, 24252061, 22001608, 20946924, 18704953, 18023905, 17207880
3-D Structure Th1014 (View) or (Download)

Primary information
ID 1101
ThPP ID Th1014
Therapeutic Peptide/Protein Name Salmon Calcitonin
Sequence CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP view full sequnce in fasta
Functional Classification Ib
Molecular Weight 3431.853
Chemical Formula C145H240N44O48S2
Isoelectric Point 8.86
Hydrophobicity -0.537
Melting Point (℃) N.A.
Half Life 0.83-1.33 hours
Description Synthetic peptide of 32 residues, formulated as a nasal spray.
Indication/Disease Used for the treatment of post-menopausal osteoporosis.
Pharmacodynamics Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney.
Mechanism of Action Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway.
Toxicity It is devoid of embryotoxic, teratogenic and mutagenic potential.
Metabolism Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule.
Absorption Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively).
Volume of Distribution N.A.
Clearance Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Lithium Carbonate ER (lithium)
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Warmth, redness, itching, or tingly feeling under your skin; nausea, loss of appetite, stomach pain
Useful Link N.A.
PubMed ID 25860966, 24708057, 24357414, 24252061, 22001608, 20946924, 18704953, 18023905, 17207880
3-D Structure Th1014 (View) or (Download)

Primary information
ID 1102
ThPP ID Th1014
Therapeutic Peptide/Protein Name Salmon Calcitonin
Sequence CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP view full sequnce in fasta
Functional Classification Ib
Molecular Weight 3431.853
Chemical Formula C145H240N44O48S2
Isoelectric Point 8.86
Hydrophobicity -0.537
Melting Point (℃) N.A.
Half Life 0.83-1.33 hours
Description Synthetic peptide of 32 residues, formulated as a nasal spray.
Indication/Disease Used for the treatment of post-menopausal osteoporosis.
Pharmacodynamics Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney.
Mechanism of Action Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway.
Toxicity It is devoid of embryotoxic, teratogenic and mutagenic potential.
Metabolism Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule.
Absorption Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively).
Volume of Distribution N.A.
Clearance Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Lithobid (lithium)
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Vomiting; skin rash or itching; increased urination, especially at night; eye pain
Useful Link N.A.
PubMed ID 25860966, 24708057, 24357414, 24252061, 22001608, 20946924, 18704953, 18023905, 17207880
3-D Structure Th1014 (View) or (Download)

Primary information
ID 1103
ThPP ID Th1014
Therapeutic Peptide/Protein Name Salmon Calcitonin
Sequence CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP view full sequnce in fasta
Functional Classification Ib
Molecular Weight 3431.853
Chemical Formula C145H240N44O48S2
Isoelectric Point 8.86
Hydrophobicity -0.537
Melting Point (℃) N.A.
Half Life 0.83-1.33 hours
Description Synthetic peptide of 32 residues, formulated as a nasal spray.
Indication/Disease Used for the treatment of post-menopausal osteoporosis.
Pharmacodynamics Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney.
Mechanism of Action Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway.
Toxicity It is devoid of embryotoxic, teratogenic and mutagenic potential.
Metabolism Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule.
Absorption Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively).
Volume of Distribution N.A.
Clearance Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Lithonate (lithium)
Target N.A.
Information of corresponding available drug in the market
Brand Name Fortical
Company N.A.
Brand Discription The active ingredient of 32 amino acids in Fortical (calcitonin-salmon of rDNA origin) nasal spray is a polypeptide manufactured by recombinant DNA technology
Prescribed for Used to treat osteoporosis in women who have been in menopause for at least 5 years. To be used along with adequate calcium and vitamin D intake.
Chemical Name N.A.
Formulation Calcitonin-salmon 2200 International Units/mL, corresponding to 200 International Units per actuation (0.09 mL) and Sodium Chloride, Citric Acid, Phenylethyl Alcohol, Benzyl Alcohol, Polysorbate 80, Hydrochloric Acid or Sodium Hydroxide (added as necess
Physcial Appearance Nasal spray
Route of Administration Intranasal use
Recommended Dosage Each spray delivers 200 International Units calcitonin-salmon in a volume of 0.09 mL.
Contraindication Allergy
Side Effects Tremors or shaking, feeling like you might pass out, severe nasal irritation.
Useful Link http://www.drugs.com/fortical.html
PubMed ID 25860966, 24708057, 24357414, 24252061, 22001608, 20946924, 18704953, 18023905, 17207880
3-D Structure Th1014 (View) or (Download)

Primary information
ID 1104
ThPP ID Th1014
Therapeutic Peptide/Protein Name Salmon Calcitonin
Sequence CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP view full sequnce in fasta
Functional Classification Ib
Molecular Weight 3431.853
Chemical Formula C145H240N44O48S2
Isoelectric Point 8.86
Hydrophobicity -0.537
Melting Point (℃) N.A.
Half Life 0.83-1.33 hours
Description Synthetic peptide of 32 residues, formulated as a nasal spray.
Indication/Disease Used for the treatment of post-menopausal osteoporosis.
Pharmacodynamics Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney.
Mechanism of Action Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway.
Toxicity It is devoid of embryotoxic, teratogenic and mutagenic potential.
Metabolism Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule.
Absorption Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively).
Volume of Distribution N.A.
Clearance Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Lithotabs (lithium)
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Bleeding from your nose, runny or stuffy nose, dryness, itching, tenderness, or general discomfort of your nose, crusting, scabs, or sores inside your nose, redness in or around your nose.
Useful Link http://www.drugs.com/drug-interactions/calcitonin,fortical-index.html?filter=1
PubMed ID 25860966, 24708057, 24357414, 24252061, 22001608, 20946924, 18704953, 18023905, 17207880
3-D Structure Th1014 (View) or (Download)

Primary information
ID 1105
ThPP ID Th1014
Therapeutic Peptide/Protein Name Salmon Calcitonin
Sequence CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP view full sequnce in fasta
Functional Classification Ib
Molecular Weight 3431.853
Chemical Formula C145H240N44O48S2
Isoelectric Point 8.86
Hydrophobicity -0.537
Melting Point (℃) N.A.
Half Life 0.83-1.33 hours
Description Synthetic peptide of 32 residues, formulated as a nasal spray.
Indication/Disease Used for the treatment of post-menopausal osteoporosis.
Pharmacodynamics Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney.
Mechanism of Action Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway.
Toxicity It is devoid of embryotoxic, teratogenic and mutagenic potential.
Metabolism Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule.
Absorption Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively).
Volume of Distribution N.A.
Clearance Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Warmth, redness, or tingly feeling under your skin, headache, back pain, nausea.
Useful Link http://www.rxlist.com/fortical-drug.htm
PubMed ID 25860966, 24708057, 24357414, 24252061, 22001608, 20946924, 18704953, 18023905, 17207880
3-D Structure Th1014 (View) or (Download)

Primary information
ID 1106
ThPP ID Th1014
Therapeutic Peptide/Protein Name Salmon Calcitonin
Sequence CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP view full sequnce in fasta
Functional Classification Ib
Molecular Weight 3431.853
Chemical Formula C145H240N44O48S2
Isoelectric Point 8.86
Hydrophobicity -0.537
Melting Point (℃) N.A.
Half Life 0.83-1.33 hours
Description Synthetic peptide of 32 residues, formulated as a nasal spray.
Indication/Disease Used for the treatment of post-menopausal osteoporosis.
Pharmacodynamics Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney.
Mechanism of Action Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway.
Toxicity It is devoid of embryotoxic, teratogenic and mutagenic potential.
Metabolism Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule.
Absorption Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively).
Volume of Distribution N.A.
Clearance Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name Miacalcin
Company Novartis
Brand Discription Miacalcin Injection is a synthetic polypeptide of 32 amino acids in the same linear sequence that is found in calcitonin of salmon origin.
Prescribed for Miacalcin Nasal Spray is used to treat osteoporosis in women who have been in menopause for at least 5 years. To be supplemented with adequate calcium and vitamin D intake.
Chemical Name N.A.
Formulation Each milliliter contains calcitonin-salmon 200 I.U., acetic acid, USP, 2.25 mg; phenol, USP, 5.0 mg; sodium acetate trihydrate, USP, 2.0 mg; sodium chloride, USP, 7.5 mg; water for injection, USP, qs to 1.0 mL
Physcial Appearance Solution
Route of Administration Subcutaneous or intramuSubcutaneousular Injection
Recommended Dosage For treatment of symptomatic Paget's disease of bone, 100 International Units (0.5 mL) per day administered subcutaneously or intramuscularly and for early treatment of hypercalcemia, 4 International Units/kg body weight every 12 hours by subcutaneous or
Contraindication Allergic, nasal or sinus problem such as nasal deformities, a chronic infection, or nasal pain.
Side Effects Tremors or shaking, feeling like you might pass out, severe nasal irritation.
Useful Link http://www.rxlist.com/miacalcin-drug.htm
PubMed ID 25860966, 24708057, 24357414, 24252061, 22001608, 20946924, 18704953, 18023905, 17207880
3-D Structure Th1014 (View) or (Download)

Primary information
ID 1107
ThPP ID Th1014
Therapeutic Peptide/Protein Name Salmon Calcitonin
Sequence CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP view full sequnce in fasta
Functional Classification Ib
Molecular Weight 3431.853
Chemical Formula C145H240N44O48S2
Isoelectric Point 8.86
Hydrophobicity -0.537
Melting Point (℃) N.A.
Half Life 0.83-1.33 hours
Description Synthetic peptide of 32 residues, formulated as a nasal spray.
Indication/Disease Used for the treatment of post-menopausal osteoporosis.
Pharmacodynamics Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney.
Mechanism of Action Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway.
Toxicity It is devoid of embryotoxic, teratogenic and mutagenic potential.
Metabolism Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule.
Absorption Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively).
Volume of Distribution N.A.
Clearance Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Bleeding from your nose, runny or stuffy nose, dryness, itching, tenderness, or general discomfort of your nose.
Useful Link http://www.drugs.com/miacalcin.html
PubMed ID 25860966, 24708057, 24357414, 24252061, 22001608, 20946924, 18704953, 18023905, 17207880
3-D Structure Th1014 (View) or (Download)

Primary information
ID 1108
ThPP ID Th1014
Therapeutic Peptide/Protein Name Salmon Calcitonin
Sequence CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP view full sequnce in fasta
Functional Classification Ib
Molecular Weight 3431.853
Chemical Formula C145H240N44O48S2
Isoelectric Point 8.86
Hydrophobicity -0.537
Melting Point (℃) N.A.
Half Life 0.83-1.33 hours
Description Synthetic peptide of 32 residues, formulated as a nasal spray.
Indication/Disease Used for the treatment of post-menopausal osteoporosis.
Pharmacodynamics Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney.
Mechanism of Action Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway.
Toxicity It is devoid of embryotoxic, teratogenic and mutagenic potential.
Metabolism Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule.
Absorption Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively).
Volume of Distribution N.A.
Clearance Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Crusting, scabs, or sores inside your nose, redness in or around your nose.
Useful Link http://www.drugs.com/dosage/miacalcin.html
PubMed ID 25860966, 24708057, 24357414, 24252061, 22001608, 20946924, 18704953, 18023905, 17207880
3-D Structure Th1014 (View) or (Download)

Primary information
ID 1109
ThPP ID Th1014
Therapeutic Peptide/Protein Name Salmon Calcitonin
Sequence CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP view full sequnce in fasta
Functional Classification Ib
Molecular Weight 3431.853
Chemical Formula C145H240N44O48S2
Isoelectric Point 8.86
Hydrophobicity -0.537
Melting Point (℃) N.A.
Half Life 0.83-1.33 hours
Description Synthetic peptide of 32 residues, formulated as a nasal spray.
Indication/Disease Used for the treatment of post-menopausal osteoporosis.
Pharmacodynamics Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney.
Mechanism of Action Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway.
Toxicity It is devoid of embryotoxic, teratogenic and mutagenic potential.
Metabolism Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule.
Absorption Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively).
Volume of Distribution N.A.
Clearance Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Warmth, redness, or tingly feeling under your skin, headache, back pain, nausea.
Useful Link http://www.webmd.com/drugs/2/drug-14128/miacalcin-nasl/details
PubMed ID 25860966, 24708057, 24357414, 24252061, 22001608, 20946924, 18704953, 18023905, 17207880
3-D Structure Th1014 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

Primary information
ID	1098
ThPP ID	Th1014
Therapeutic Peptide/Protein Name	Salmon Calcitonin
Sequence	CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	3431.853
Chemical Formula	C145H240N44O48S2
Isoelectric Point	8.86
Hydrophobicity	-0.537
Melting Point (℃)	N.A.
Half Life	0.83-1.33 hours
Description	Synthetic peptide of 32 residues, formulated as a nasal spray.
Indication/Disease	Used for the treatment of post-menopausal osteoporosis.
Pharmacodynamics	Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney.
Mechanism of Action	Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway.
Toxicity	It is devoid of embryotoxic, teratogenic and mutagenic potential.
Metabolism	Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule.
Absorption	Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively).
Volume of Distribution	N.A.
Clearance	Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney.
Categories	Bone Density Conservation Agents
Patents Number	US6440392
Date of Issue	02/02/01
Date of Expiry	02/02/21
Drug Interaction	Eskalith (lithium)
Target	Calcitonin receptor
Information of corresponding available drug in the market
Brand Name	Calcimar
Company	N.A.
Brand Discription	Calcitonin is a group of polypeptide hormones secreted by the thyroid gland in mammals and by the ultimobranchial gland of birds and fish. It is of physiological importance in the regulation of calcium metabolism in certain animal species, and may also ha
Prescribed for	To treat Paget's disease of bone
Chemical Name	N.A.
Formulation	Each mL of sterile solution contains calcitonin salmon 200 IU. Nonmedicinal ingredients include acetic acid, phenol, sodium acetate, sodium chloride, sodium hydroxide and water for injection.
Physcial Appearance	Solution
Route of Administration	Subcutaneous or intramuSubcutaneousular Injection
Recommended Dosage	Based on body weight and injected every 12 hours
Contraindication	Allergy
Side Effects	Feeling light-headed, fainting; or muscle stiffness.
Useful Link	http://www.drugs.com/sfx/calcimar-side-effects.html
PubMed ID	25860966, 24708057, 24357414, 24252061, 22001608, 20946924, 18704953, 18023905, 17207880
3-D Structure	Th1014 (View) or (Download)

Primary information
ID	1099
ThPP ID	Th1014
Therapeutic Peptide/Protein Name	Salmon Calcitonin
Sequence	CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	3431.853
Chemical Formula	C145H240N44O48S2
Isoelectric Point	8.86
Hydrophobicity	-0.537
Melting Point (℃)	N.A.
Half Life	0.83-1.33 hours
Description	Synthetic peptide of 32 residues, formulated as a nasal spray.
Indication/Disease	Used for the treatment of post-menopausal osteoporosis.
Pharmacodynamics	Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney.
Mechanism of Action	Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway.
Toxicity	It is devoid of embryotoxic, teratogenic and mutagenic potential.
Metabolism	Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule.
Absorption	Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively).
Volume of Distribution	N.A.
Clearance	Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney.
Categories	Antihypercalcemic Agents
Patents Number	US5733569
Date of Issue	31/03/95
Date of Expiry	31/03/15
Drug Interaction	Eskalith-CR (lithium)
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	For treatment of postmenopausal osteoporosis
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Swelling in your feet
Useful Link	http://www.drugs.com/drug-interactions/calcitonin-index.html?filter=1
PubMed ID	25860966, 24708057, 24357414, 24252061, 22001608, 20946924, 18704953, 18023905, 17207880
3-D Structure	Th1014 (View) or (Download)

Primary information
ID	1100
ThPP ID	Th1014
Therapeutic Peptide/Protein Name	Salmon Calcitonin
Sequence	CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	3431.853
Chemical Formula	C145H240N44O48S2
Isoelectric Point	8.86
Hydrophobicity	-0.537
Melting Point (℃)	N.A.
Half Life	0.83-1.33 hours
Description	Synthetic peptide of 32 residues, formulated as a nasal spray.
Indication/Disease	Used for the treatment of post-menopausal osteoporosis.
Pharmacodynamics	Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney.
Mechanism of Action	Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway.
Toxicity	It is devoid of embryotoxic, teratogenic and mutagenic potential.
Metabolism	Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule.
Absorption	Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively).
Volume of Distribution	N.A.
Clearance	Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney.
Categories	Anti-Osteporotic Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Foscavir (foscarnet)
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	To reduce high levels of calcium in the blood (hypercalcemia)
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Swelling or irritation of the skin where an injection was given.
Useful Link	http://www.rxmed.com/b.main/b2.pharmaceutical/b2.1.monographs/CPS-%20Monographs/CPS-%20%28General%20Monographs-%20C%29/CALCIMAR.html
PubMed ID	25860966, 24708057, 24357414, 24252061, 22001608, 20946924, 18704953, 18023905, 17207880
3-D Structure	Th1014 (View) or (Download)

Primary information
ID	1101
ThPP ID	Th1014
Therapeutic Peptide/Protein Name	Salmon Calcitonin
Sequence	CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	3431.853
Chemical Formula	C145H240N44O48S2
Isoelectric Point	8.86
Hydrophobicity	-0.537
Melting Point (℃)	N.A.
Half Life	0.83-1.33 hours
Description	Synthetic peptide of 32 residues, formulated as a nasal spray.
Indication/Disease	Used for the treatment of post-menopausal osteoporosis.
Pharmacodynamics	Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney.
Mechanism of Action	Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway.
Toxicity	It is devoid of embryotoxic, teratogenic and mutagenic potential.
Metabolism	Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule.
Absorption	Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively).
Volume of Distribution	N.A.
Clearance	Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Lithium Carbonate ER (lithium)
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Warmth, redness, itching, or tingly feeling under your skin; nausea, loss of appetite, stomach pain
Useful Link	N.A.
PubMed ID	25860966, 24708057, 24357414, 24252061, 22001608, 20946924, 18704953, 18023905, 17207880
3-D Structure	Th1014 (View) or (Download)

Primary information
ID	1102
ThPP ID	Th1014
Therapeutic Peptide/Protein Name	Salmon Calcitonin
Sequence	CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	3431.853
Chemical Formula	C145H240N44O48S2
Isoelectric Point	8.86
Hydrophobicity	-0.537
Melting Point (℃)	N.A.
Half Life	0.83-1.33 hours
Description	Synthetic peptide of 32 residues, formulated as a nasal spray.
Indication/Disease	Used for the treatment of post-menopausal osteoporosis.
Pharmacodynamics	Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney.
Mechanism of Action	Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway.
Toxicity	It is devoid of embryotoxic, teratogenic and mutagenic potential.
Metabolism	Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule.
Absorption	Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively).
Volume of Distribution	N.A.
Clearance	Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Lithobid (lithium)
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Vomiting; skin rash or itching; increased urination, especially at night; eye pain
Useful Link	N.A.
PubMed ID	25860966, 24708057, 24357414, 24252061, 22001608, 20946924, 18704953, 18023905, 17207880
3-D Structure	Th1014 (View) or (Download)

Primary information
ID	1103
ThPP ID	Th1014
Therapeutic Peptide/Protein Name	Salmon Calcitonin
Sequence	CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	3431.853
Chemical Formula	C145H240N44O48S2
Isoelectric Point	8.86
Hydrophobicity	-0.537
Melting Point (℃)	N.A.
Half Life	0.83-1.33 hours
Description	Synthetic peptide of 32 residues, formulated as a nasal spray.
Indication/Disease	Used for the treatment of post-menopausal osteoporosis.
Pharmacodynamics	Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney.
Mechanism of Action	Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway.
Toxicity	It is devoid of embryotoxic, teratogenic and mutagenic potential.
Metabolism	Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule.
Absorption	Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively).
Volume of Distribution	N.A.
Clearance	Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Lithonate (lithium)
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Fortical
Company	N.A.
Brand Discription	The active ingredient of 32 amino acids in Fortical (calcitonin-salmon of rDNA origin) nasal spray is a polypeptide manufactured by recombinant DNA technology
Prescribed for	Used to treat osteoporosis in women who have been in menopause for at least 5 years. To be used along with adequate calcium and vitamin D intake.
Chemical Name	N.A.
Formulation	Calcitonin-salmon 2200 International Units/mL, corresponding to 200 International Units per actuation (0.09 mL) and Sodium Chloride, Citric Acid, Phenylethyl Alcohol, Benzyl Alcohol, Polysorbate 80, Hydrochloric Acid or Sodium Hydroxide (added as necess
Physcial Appearance	Nasal spray
Route of Administration	Intranasal use
Recommended Dosage	Each spray delivers 200 International Units calcitonin-salmon in a volume of 0.09 mL.
Contraindication	Allergy
Side Effects	Tremors or shaking, feeling like you might pass out, severe nasal irritation.
Useful Link	http://www.drugs.com/fortical.html
PubMed ID	25860966, 24708057, 24357414, 24252061, 22001608, 20946924, 18704953, 18023905, 17207880
3-D Structure	Th1014 (View) or (Download)

Primary information
ID	1104
ThPP ID	Th1014
Therapeutic Peptide/Protein Name	Salmon Calcitonin
Sequence	CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	3431.853
Chemical Formula	C145H240N44O48S2
Isoelectric Point	8.86
Hydrophobicity	-0.537
Melting Point (℃)	N.A.
Half Life	0.83-1.33 hours
Description	Synthetic peptide of 32 residues, formulated as a nasal spray.
Indication/Disease	Used for the treatment of post-menopausal osteoporosis.
Pharmacodynamics	Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney.
Mechanism of Action	Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway.
Toxicity	It is devoid of embryotoxic, teratogenic and mutagenic potential.
Metabolism	Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule.
Absorption	Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively).
Volume of Distribution	N.A.
Clearance	Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Lithotabs (lithium)
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Bleeding from your nose, runny or stuffy nose, dryness, itching, tenderness, or general discomfort of your nose, crusting, scabs, or sores inside your nose, redness in or around your nose.
Useful Link	http://www.drugs.com/drug-interactions/calcitonin,fortical-index.html?filter=1
PubMed ID	25860966, 24708057, 24357414, 24252061, 22001608, 20946924, 18704953, 18023905, 17207880
3-D Structure	Th1014 (View) or (Download)

Primary information
ID	1105
ThPP ID	Th1014
Therapeutic Peptide/Protein Name	Salmon Calcitonin
Sequence	CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	3431.853
Chemical Formula	C145H240N44O48S2
Isoelectric Point	8.86
Hydrophobicity	-0.537
Melting Point (℃)	N.A.
Half Life	0.83-1.33 hours
Description	Synthetic peptide of 32 residues, formulated as a nasal spray.
Indication/Disease	Used for the treatment of post-menopausal osteoporosis.
Pharmacodynamics	Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney.
Mechanism of Action	Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway.
Toxicity	It is devoid of embryotoxic, teratogenic and mutagenic potential.
Metabolism	Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule.
Absorption	Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively).
Volume of Distribution	N.A.
Clearance	Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Warmth, redness, or tingly feeling under your skin, headache, back pain, nausea.
Useful Link	http://www.rxlist.com/fortical-drug.htm
PubMed ID	25860966, 24708057, 24357414, 24252061, 22001608, 20946924, 18704953, 18023905, 17207880
3-D Structure	Th1014 (View) or (Download)

Primary information
ID	1106
ThPP ID	Th1014
Therapeutic Peptide/Protein Name	Salmon Calcitonin
Sequence	CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	3431.853
Chemical Formula	C145H240N44O48S2
Isoelectric Point	8.86
Hydrophobicity	-0.537
Melting Point (℃)	N.A.
Half Life	0.83-1.33 hours
Description	Synthetic peptide of 32 residues, formulated as a nasal spray.
Indication/Disease	Used for the treatment of post-menopausal osteoporosis.
Pharmacodynamics	Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney.
Mechanism of Action	Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway.
Toxicity	It is devoid of embryotoxic, teratogenic and mutagenic potential.
Metabolism	Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule.
Absorption	Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively).
Volume of Distribution	N.A.
Clearance	Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Miacalcin
Company	Novartis
Brand Discription	Miacalcin Injection is a synthetic polypeptide of 32 amino acids in the same linear sequence that is found in calcitonin of salmon origin.
Prescribed for	Miacalcin Nasal Spray is used to treat osteoporosis in women who have been in menopause for at least 5 years. To be supplemented with adequate calcium and vitamin D intake.
Chemical Name	N.A.
Formulation	Each milliliter contains calcitonin-salmon 200 I.U., acetic acid, USP, 2.25 mg; phenol, USP, 5.0 mg; sodium acetate trihydrate, USP, 2.0 mg; sodium chloride, USP, 7.5 mg; water for injection, USP, qs to 1.0 mL
Physcial Appearance	Solution
Route of Administration	Subcutaneous or intramuSubcutaneousular Injection
Recommended Dosage	For treatment of symptomatic Paget's disease of bone, 100 International Units (0.5 mL) per day administered subcutaneously or intramuscularly and for early treatment of hypercalcemia, 4 International Units/kg body weight every 12 hours by subcutaneous or
Contraindication	Allergic, nasal or sinus problem such as nasal deformities, a chronic infection, or nasal pain.
Side Effects	Tremors or shaking, feeling like you might pass out, severe nasal irritation.
Useful Link	http://www.rxlist.com/miacalcin-drug.htm
PubMed ID	25860966, 24708057, 24357414, 24252061, 22001608, 20946924, 18704953, 18023905, 17207880
3-D Structure	Th1014 (View) or (Download)

Primary information
ID	1107
ThPP ID	Th1014
Therapeutic Peptide/Protein Name	Salmon Calcitonin
Sequence	CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	3431.853
Chemical Formula	C145H240N44O48S2
Isoelectric Point	8.86
Hydrophobicity	-0.537
Melting Point (℃)	N.A.
Half Life	0.83-1.33 hours
Description	Synthetic peptide of 32 residues, formulated as a nasal spray.
Indication/Disease	Used for the treatment of post-menopausal osteoporosis.
Pharmacodynamics	Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney.
Mechanism of Action	Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway.
Toxicity	It is devoid of embryotoxic, teratogenic and mutagenic potential.
Metabolism	Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule.
Absorption	Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively).
Volume of Distribution	N.A.
Clearance	Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Bleeding from your nose, runny or stuffy nose, dryness, itching, tenderness, or general discomfort of your nose.
Useful Link	http://www.drugs.com/miacalcin.html
PubMed ID	25860966, 24708057, 24357414, 24252061, 22001608, 20946924, 18704953, 18023905, 17207880
3-D Structure	Th1014 (View) or (Download)

Primary information
ID	1108
ThPP ID	Th1014
Therapeutic Peptide/Protein Name	Salmon Calcitonin
Sequence	CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	3431.853
Chemical Formula	C145H240N44O48S2
Isoelectric Point	8.86
Hydrophobicity	-0.537
Melting Point (℃)	N.A.
Half Life	0.83-1.33 hours
Description	Synthetic peptide of 32 residues, formulated as a nasal spray.
Indication/Disease	Used for the treatment of post-menopausal osteoporosis.
Pharmacodynamics	Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney.
Mechanism of Action	Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway.
Toxicity	It is devoid of embryotoxic, teratogenic and mutagenic potential.
Metabolism	Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule.
Absorption	Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively).
Volume of Distribution	N.A.
Clearance	Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Crusting, scabs, or sores inside your nose, redness in or around your nose.
Useful Link	http://www.drugs.com/dosage/miacalcin.html
PubMed ID	25860966, 24708057, 24357414, 24252061, 22001608, 20946924, 18704953, 18023905, 17207880
3-D Structure	Th1014 (View) or (Download)

Primary information
ID	1109
ThPP ID	Th1014
Therapeutic Peptide/Protein Name	Salmon Calcitonin
Sequence	CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	3431.853
Chemical Formula	C145H240N44O48S2
Isoelectric Point	8.86
Hydrophobicity	-0.537
Melting Point (℃)	N.A.
Half Life	0.83-1.33 hours
Description	Synthetic peptide of 32 residues, formulated as a nasal spray.
Indication/Disease	Used for the treatment of post-menopausal osteoporosis.
Pharmacodynamics	Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney.
Mechanism of Action	Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway.
Toxicity	It is devoid of embryotoxic, teratogenic and mutagenic potential.
Metabolism	Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule.
Absorption	Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively).
Volume of Distribution	N.A.
Clearance	Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Warmth, redness, or tingly feeling under your skin, headache, back pain, nausea.
Useful Link	http://www.webmd.com/drugs/2/drug-14128/miacalcin-nasl/details
PubMed ID	25860966, 24708057, 24357414, 24252061, 22001608, 20946924, 18704953, 18023905, 17207880
3-D Structure	Th1014 (View) or (Download)

Updated version of this database is available at ThpDB2

Detailed description page of THPdb