Detailed description page of THPdb

This page displays user query in tabular form.

Th1013 details

Primary information
ID 1071
ThPP ID Th1013
Therapeutic Peptide/Protein Name Epoetin alfa
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18396.1
Chemical Formula C815H1317N233O241S5
Isoelectric Point 8.75
Hydrophobicity N.A.
Melting Point (℃) 53
Half Life N.A.
Description It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 20.2 Â± 15.9 mL/h/kg [150 Units/kg SC TIW, Week 1 when anemic cancer patients were receiving chemotherapy]
Categories Hematinics
Patents Number CA1339047
Date of Issue 27/05/97
Date of Expiry 27/05/14
Drug Interaction N.A.
Target Erythropoietin receptor
Information of corresponding available drug in the market
Brand Name Binocrit
Company Sandoz
Brand Discription Binocrit is a solution administered as an injection. It is available in pre-filled syringes that contain 1,000-40,000 international units (IU) of the active substance, epoetin alfa
Prescribed for Treatment of symptomatic anaemia associated with chronic renal failure (CRF) in adult and paediatric patients
Chemical Name N.A.
Formulation 1000 IU/0.5 ml means that each ml of solution contains 2000 IU of epoetin alfa corresponding to 16.8 micrograms per ml. One pre-filled syringe of 0.5 ml contains 1000 international units (IU) corresponding to 8.4 micrograms epoetin alfa
Physcial Appearance Clear colourless solution
Route of Administration Subcutaneous and Intravenous infusion
Recommended Dosage For less than 10 kg of weight usual maintainence dose is 75-150 (IU/kg given 3x/week). For 10-30 kg weight usual maintainence dose is 60-150 (IU/kg given 3x/week). For more than 30 kg weight usual maintainence dose is 30-100 (IU/kg given 3x/week).
Contraindication Hypersensitivity, uncontrooled hypertension, Patients who develop Pure Red Cell Aplasia (PRCA) following treatment with any erythropoietin should not receive Binocrit, Patients who develop Pure Red Cell Aplasia (PRCA) following treatment with any erythropoetin.
Side Effects The most frequent adverse reaction during treatment with epoetin alfa is a dose-dependent increase in blood pressure or aggravation of existing hypertension in cancer patients and in chronic renal failure patients.
Useful Link https://www.medicines.org.uk/emc/medicine/21625
PubMed ID 20369312, 18208642
3-D Structure Th1013 (View) or (Download)

Primary information
ID 1072
ThPP ID Th1013
Therapeutic Peptide/Protein Name Epoetin alfa
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18396.1
Chemical Formula C815H1317N233O241S5
Isoelectric Point 8.75
Hydrophobicity N.A.
Melting Point (℃) 53
Half Life N.A.
Description It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 13.9 Â± 7.6 mL/h/kg [40,000 Units/kg SC TIW, Week 3 when anemic cancer patients were not receiving chemotherapy]
Categories Anti-anemic Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Other common adverse reactions observed in clinical trials of epoetin alfa are deep vein thrombosis, influenza like illness, pyrexia, rash, pulmonary embolism, seizures, diarrhoea, nausea, headache, and vomiting. Influenza like illness including headaches
Useful Link http://www.drugs.com/international/binocrit.html
PubMed ID 20369312, 18208642
3-D Structure Th1013 (View) or (Download)

Primary information
ID 1073
ThPP ID Th1013
Therapeutic Peptide/Protein Name Epoetin alfa
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18396.1
Chemical Formula C815H1317N233O241S5
Isoelectric Point 8.75
Hydrophobicity N.A.
Melting Point (℃) 53
Half Life N.A.
Description It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 23.6 Â± 9.5 mL/h/kg [150 Units/kg SC TIW, Week 3 when anemic cancer patients were not receiving chemotherapy]
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name Epocept
Company Lupin pharma
Brand Discription N.A.
Prescribed for To treat anaemia associated with chronic renal failure and cancer chemotherapy. Anaemia associated with Zidovudine therapy in AIDS patients can also be treated with it.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration Injection
Recommended Dosage Starts with 25 to 50 i.u./kg over 1 to 2 minutes; thrice weekly. Increases the dosage in increments of 25 i.u./kg at intervals of four week.
Contraindication Pregnancy and old age
Side Effects Nausea, stomach upset, skin rashes and acute toxicity
Useful Link http://www.medclik.com/General/pages/Drugmanual/BrandSearch/EPOCEPT.asp
PubMed ID 20369312, 18208642
3-D Structure Th1013 (View) or (Download)

Primary information
ID 1074
ThPP ID Th1013
Therapeutic Peptide/Protein Name Epoetin alfa
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18396.1
Chemical Formula C815H1317N233O241S5
Isoelectric Point 8.75
Hydrophobicity N.A.
Melting Point (℃) 53
Half Life N.A.
Description It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 9.2 Â± 4.7 mL/h/kg [40,000 Units/kg SC TIW, Week 1 when anemic cancer patients were receiving chemotherapy]
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Children
Side Effects N.A.
Useful Link http://kelo.in/drugs/lupin-limited/epocept-4000iu-inj-1ml/
PubMed ID 20369312, 18208642
3-D Structure Th1013 (View) or (Download)

Primary information
ID 1075
ThPP ID Th1013
Therapeutic Peptide/Protein Name Epoetin alfa
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18396.1
Chemical Formula C815H1317N233O241S5
Isoelectric Point 8.75
Hydrophobicity N.A.
Melting Point (℃) 53
Half Life N.A.
Description It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name Epofit
Company Intas pharma
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 20369312, 18208642
3-D Structure Th1013 (View) or (Download)

Primary information
ID 1076
ThPP ID Th1013
Therapeutic Peptide/Protein Name Epoetin alfa
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18396.1
Chemical Formula C815H1317N233O241S5
Isoelectric Point 8.75
Hydrophobicity N.A.
Melting Point (℃) 53
Half Life N.A.
Description It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name Epogen
Company Amgen Inc.
Brand Discription Epogen(165-amino acid, 30,400 daltons) is an erythropoiesis-stimulating glycoprotein manufactured by recombinant DNA technology. It is produced by mammalian cells into which the human erythropoietin gene has been introduced. The product contains the ident
Prescribed for Epogen is used to treat anemia in patients with chronic kidney disease. Epogen is also used in HIV patients who have anemia due to treatment with zidovudine and in cancer patients who have anemia due to chemotherapy.
Chemical Name N.A.
Formulation Each 1 mL vial contains 2000, 3000, 4000, or 10,000 Units of epoetin alfa, Albumin (Human) (2.5 mg), citric acid (0.06 mg), sodium chloride (5.9 mg), and sodium citrate (5.8 mg) in Water for Injection, USP (pH 6.9 Â± 0.3). Single-dose 1 mL vials formulated
Physcial Appearance Sterile, colorless liquid
Route of Administration Subcutaneous Injection
Recommended Dosage N.A.
Contraindication Allergic, untreated or uncontrolled high blood pressure; or if you have ever had pure red cell aplasia (PRCA, a type of anemia) caused by using darbepoetin alfa or epoetin alfa.
Side Effects Feeling light-headed, fainting; fever, chills, body aches, flu symptoms, sores in your mouth and throat; pale skin, feeling short of breath, rapid heart rate, trouble concentrating; easy bruising, unusual bleeding (nose, mouth, vagina, or rectum), purple
Useful Link http://www.drugs.com/epogen.html
PubMed ID 20369312, 18208642
3-D Structure Th1013 (View) or (Download)

Primary information
ID 1077
ThPP ID Th1013
Therapeutic Peptide/Protein Name Epoetin alfa
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18396.1
Chemical Formula C815H1317N233O241S5
Isoelectric Point 8.75
Hydrophobicity N.A.
Melting Point (℃) 53
Half Life N.A.
Description It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Cold symptoms such as stuffy nose, sneezing, cough, sore throat; joint pain, bone pain; muscle pain, muscle spasm; dizziness, depression, mild headache; weight loss; sleep problems (insomnia); nausea, vomiting, trouble swallowing; or pain or tenderness
Useful Link http://www.drugs.com/drug-interactions/epoetin-alfa,epogen-index.html?filter=1
PubMed ID 20369312, 18208642
3-D Structure Th1013 (View) or (Download)

Primary information
ID 1078
ThPP ID Th1013
Therapeutic Peptide/Protein Name Epoetin alfa
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18396.1
Chemical Formula C815H1317N233O241S5
Isoelectric Point 8.75
Hydrophobicity N.A.
Melting Point (℃) 53
Half Life N.A.
Description It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Dangerously high blood pressure (severe headache, blurred vision, buzzing in your ears, anxiety, confusion, chest pain, shortness of breath, uneven heartbeats, seizure)
Useful Link http://www.rxlist.com/epogen-drug.htm
PubMed ID 20369312, 18208642
3-D Structure Th1013 (View) or (Download)

Primary information
ID 1079
ThPP ID Th1013
Therapeutic Peptide/Protein Name Epoetin alfa
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18396.1
Chemical Formula C815H1317N233O241S5
Isoelectric Point 8.75
Hydrophobicity N.A.
Melting Point (℃) 53
Half Life N.A.
Description It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name Epogin
Company Chugai
Brand Discription Epogin is a recombinant human erythropoetin
Prescribed for EPOGIN Injection (EPOGIN Injection Syringe, EPOGIN Injection Ampule) has been widely used in the clinical settings for its approved indications of renal anemia under dialysis and before dialysis, immature infant anemia, and the autologous blood transfusio
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration Subcutaneous and Intravenous infusion
Recommended Dosage The autologous blood transfusion, the intravenous administration of Epogin at 6000 units/per time for three times a week on alternative days has been already approved for three forms of â€œEpogin Injection 1500, 3000 and 6000.
Contraindication N.A.
Side Effects Nausea, fatigue, and vomiting.
Useful Link http://www.chugai-pharm.co.jp/english/news/detail/20100618161500.html
PubMed ID 20369312, 18208642
3-D Structure Th1013 (View) or (Download)

Primary information
ID 1080
ThPP ID Th1013
Therapeutic Peptide/Protein Name Epoetin alfa
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18396.1
Chemical Formula C815H1317N233O241S5
Isoelectric Point 8.75
Hydrophobicity N.A.
Melting Point (℃) 53
Half Life N.A.
Description It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://kidneys.emedtv.com/epogen/epogin.html
PubMed ID 20369312, 18208642
3-D Structure Th1013 (View) or (Download)

Primary information
ID 1081
ThPP ID Th1013
Therapeutic Peptide/Protein Name Epoetin alfa
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18396.1
Chemical Formula C815H1317N233O241S5
Isoelectric Point 8.75
Hydrophobicity N.A.
Melting Point (℃) 53
Half Life N.A.
Description It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.firstwordpharma.com/node/419848#axzz3Hzwz2gXV
PubMed ID 20369312, 18208642
3-D Structure Th1013 (View) or (Download)

Primary information
ID 1082
ThPP ID Th1013
Therapeutic Peptide/Protein Name Epoetin alfa
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18396.1
Chemical Formula C815H1317N233O241S5
Isoelectric Point 8.75
Hydrophobicity N.A.
Melting Point (℃) 53
Half Life N.A.
Description It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name Eprex
Company Janssen-Cilag. Ortho Biologics LLC
Brand Discription Eprex is synthetic erythropoietin and is used to replace the erythropoietin that is lacking in people who can't make enough, usually because their kidneys are not working properly.
Prescribed for To treat patients with symptomatic or transfusion requiring anaemia associated with chronic renal failure to improve their quality of life.
Chemical Name N.A.
Formulation Each mL of sterile solution contains epoetin alfa 1,000 IU, 2,000 IU, 4,000 IU, 10,000 IU, or 40,000 IU. Nonmedicinal ingredients include glycine and polysorbate 80 as stabilizers, sodium chloride, sodium phosphate dibasic dihydrate, sodium phosphate mono
Physcial Appearance Solution
Route of Administration Subcutaneous and Intravenous infusion
Recommended Dosage For children with chronic renal failure, the starting dose for anemia is 50 units (IU) per kilogram body weight, given 3 times a week. For adults with chronic renal failure, the starting dose for anemia is 50 to 100 units per kilogram of body weight.
Contraindication Uncontrolled hypertension
Side Effects Clotting of the vascular access site (for people on hemodialysis), dehydration, diarrhea, edema (swelling of the face, fingers, ankles, feet, or lower legs), headache, increased or decreased blood pressure, dizziness, or feeling faint, muscle aches and weakness.
Useful Link https://www.janssen.com.au/files/Products/Eprex_PI.pdf?681ab03dec4d61f87c927b9559c69e7a
PubMed ID 20369312, 18208642
3-D Structure Th1013 (View) or (Download)

Primary information
ID 1083
ThPP ID Th1013
Therapeutic Peptide/Protein Name Epoetin alfa
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18396.1
Chemical Formula C815H1317N233O241S5
Isoelectric Point 8.75
Hydrophobicity N.A.
Melting Point (℃) 53
Half Life N.A.
Description It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for For treatment of anaemia and reduction of transfusion in patients with non-myeloid malignancies where anaemia develops as a result of concomitantly administered chemotherapy.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Known sensitivity to mammalian cell derived products
Side Effects Signs of allergic reaction (symptoms may include skin rash or hives, trouble breathing, sweating, abnormal heart rate, or decreased blood pressure)
Useful Link http://chealth.canoe.ca/drug_info_details.asp?channel_id=0&relation_id=0&brand_name_id=1174&page_no=2
PubMed ID 20369312, 18208642
3-D Structure Th1013 (View) or (Download)

Primary information
ID 1084
ThPP ID Th1013
Therapeutic Peptide/Protein Name Epoetin alfa
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18396.1
Chemical Formula C815H1317N233O241S5
Isoelectric Point 8.75
Hydrophobicity N.A.
Melting Point (℃) 53
Half Life N.A.
Description It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for In adult patients with mild-to-moderate anaemia (haemoglobin >10 to< 13g/dL) scheduled for elective surgery with an expected moderate blood loss (2-4 units or 900-1800mL) to reduce exposure to allogeneic blood transfusion and to facilitate erythropoietic
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Hypersensitivity to the active substance or to any of the excipients
Side Effects Signs of blood clots (pain or swelling in the legs, worsening shortness of breath, coughing up blood)
Useful Link N.A.
PubMed ID 20369312, 18208642
3-D Structure Th1013 (View) or (Download)

Primary information
ID 1085
ThPP ID Th1013
Therapeutic Peptide/Protein Name Epoetin alfa
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18396.1
Chemical Formula C815H1317N233O241S5
Isoelectric Point 8.75
Hydrophobicity N.A.
Melting Point (℃) 53
Half Life N.A.
Description It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for To augment autologous blood collection and to limit the decline in haemoglobin in anaemic adult patients who are scheduled for major elective surgery and who are not expected to pre-deposit their complete peri-operative blood needs.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Patients scheduled for elective surgery, who are not participating in an autologous blood pre-deposit programme and who have severe coronary, peripheral arterial, carotid or cerebral vascular disease, including patients with recent myocardial infarction or cerebral vascular accident.
Side Effects Signs of stroke (confusion, severe headache, sudden weakness, dizziness, trouble speaking, or vision problems)
Useful Link N.A.
PubMed ID 20369312, 18208642
3-D Structure Th1013 (View) or (Download)

Primary information
ID 1086
ThPP ID Th1013
Therapeutic Peptide/Protein Name Epoetin alfa
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18396.1
Chemical Formula C815H1317N233O241S5
Isoelectric Point 8.75
Hydrophobicity N.A.
Melting Point (℃) 53
Half Life N.A.
Description It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Surgery patients who for any reason cannot receive adequate antithrombotic prophylaxis or treatment.
Side Effects N.A.
Useful Link N.A.
PubMed ID 20369312, 18208642
3-D Structure Th1013 (View) or (Download)

Primary information
ID 1087
ThPP ID Th1013
Therapeutic Peptide/Protein Name Epoetin alfa
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18396.1
Chemical Formula C815H1317N233O241S5
Isoelectric Point 8.75
Hydrophobicity N.A.
Melting Point (℃) 53
Half Life N.A.
Description It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Patients who develop Pure Red Cell Aplasia (PRCA) following treatment with any erythropoietin should not receive EPREX or any other erythropoietin
Side Effects N.A.
Useful Link N.A.
PubMed ID 20369312, 18208642
3-D Structure Th1013 (View) or (Download)

Primary information
ID 1088
ThPP ID Th1013
Therapeutic Peptide/Protein Name Epoetin alfa
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18396.1
Chemical Formula C815H1317N233O241S5
Isoelectric Point 8.75
Hydrophobicity N.A.
Melting Point (℃) 53
Half Life N.A.
Description It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name Nanokine
Company Nanogen Pharmaceutical biotechnology, Vietnam)
Brand Discription NANOKINE is produced from raw, high purity material erythropoietin (EPO). Material EPO is produced by recombinant DNA techniques on ovarian cell lines marsupial cheeks of China (Chinese Hamster ovary, CHO). EPO gene coding for the protein was transferred
Prescribed for Used in treatment of anaemia associated with chronic renal failure in paediatric and adult patients on haemodialysis and adult patients on peritoneal dialysis
Chemical Name N.A.
Formulation N.A.
Physcial Appearance Sterile, white, lyophilized powder. The reconstituted preparation with 1 ml solvent (containing 0.9% benzyl alcohol) results in a clear, colorless solution.
Route of Administration Injection
Recommended Dosage N.A.
Contraindication Uncontrolled hypertension
Side Effects N.A.
Useful Link http://www.nanogenpharma.com/index.php?lang=en&com=product&act=detail&id=1#sthash.UbSsxMNf.dpuf
PubMed ID 20369312, 18208642
3-D Structure Th1013 (View) or (Download)

Primary information
ID 1089
ThPP ID Th1013
Therapeutic Peptide/Protein Name Epoetin alfa
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18396.1
Chemical Formula C815H1317N233O241S5
Isoelectric Point 8.75
Hydrophobicity N.A.
Melting Point (℃) 53
Half Life N.A.
Description It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for To treat severe anaemia of renal origin accompanied by clinical symptoms in adult patients with renal insufficiency not yet undergoing dialysis.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Develop pure red cell aplasia (PRCA) following treatment with erythropoietin
Side Effects N.A.
Useful Link http://www.nanogenpharma.com/index.php?lang=en&com=product&act=detail&id=1
PubMed ID 20369312, 18208642
3-D Structure Th1013 (View) or (Download)

Primary information
ID 1090
ThPP ID Th1013
Therapeutic Peptide/Protein Name Epoetin alfa
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18396.1
Chemical Formula C815H1317N233O241S5
Isoelectric Point 8.75
Hydrophobicity N.A.
Melting Point (℃) 53
Half Life N.A.
Description It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Hypersensitivity to the active substance or to any of the excipients.
Side Effects N.A.
Useful Link N.A.
PubMed ID 20369312, 18208642
3-D Structure Th1013 (View) or (Download)

Primary information
ID 1091
ThPP ID Th1013
Therapeutic Peptide/Protein Name Epoetin alfa
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18396.1
Chemical Formula C815H1317N233O241S5
Isoelectric Point 8.75
Hydrophobicity N.A.
Melting Point (℃) 53
Half Life N.A.
Description It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Have surgery and cannot receive adequate antithrombotic prophylaxis for any reason.
Side Effects N.A.
Useful Link N.A.
PubMed ID 20369312, 18208642
3-D Structure Th1013 (View) or (Download)

Primary information
ID 1092
ThPP ID Th1013
Therapeutic Peptide/Protein Name Epoetin alfa
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18396.1
Chemical Formula C815H1317N233O241S5
Isoelectric Point 8.75
Hydrophobicity N.A.
Melting Point (℃) 53
Half Life N.A.
Description It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Have autologous blood predonation programmes
Side Effects N.A.
Useful Link N.A.
PubMed ID 20369312, 18208642
3-D Structure Th1013 (View) or (Download)

Primary information
ID 1093
ThPP ID Th1013
Therapeutic Peptide/Protein Name Epoetin alfa
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18396.1
Chemical Formula C815H1317N233O241S5
Isoelectric Point 8.75
Hydrophobicity N.A.
Melting Point (℃) 53
Half Life N.A.
Description It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Are scheduled for major elective orthopaedic surgery and not participating in an autologous blood predonation
Side Effects N.A.
Useful Link N.A.
PubMed ID 20369312, 18208642
3-D Structure Th1013 (View) or (Download)

Primary information
ID 1094
ThPP ID Th1013
Therapeutic Peptide/Protein Name Epoetin alfa
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18396.1
Chemical Formula C815H1317N233O241S5
Isoelectric Point 8.75
Hydrophobicity N.A.
Melting Point (℃) 53
Half Life N.A.
Description It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Suffer severe coronary, peripheral arterial, carotid or cerebral vascular disease, including patients with recent myocardial infarction or cerebral vascular accident.
Side Effects N.A.
Useful Link N.A.
PubMed ID 20369312, 18208642
3-D Structure Th1013 (View) or (Download)

Primary information
ID 1095
ThPP ID Th1013
Therapeutic Peptide/Protein Name Epoetin alfa
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18396.1
Chemical Formula C815H1317N233O241S5
Isoelectric Point 8.75
Hydrophobicity N.A.
Melting Point (℃) 53
Half Life N.A.
Description It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name Procrit
Company Ortho Biotech
Brand Discription PROCRIT(165 amino acid, 30,400 daltons) is a glycoprotein manufactured by recombinant DNA technology having the same biological effects as endogenous erythropoietin.It is produced by mammalian cells into which the human erythropoietin gene has been introd
Prescribed for Used to treat anemia in patients with Chronic Kidney Disease (CKD). Procrit is also used to treat anemia caused by zidovudine in HIV-infected patients and in certain patients receiving chemotherapy.
Chemical Name N.A.
Formulation Each 1 mL of solution contains 2000, 3000, 4000 or 10,000 Units of Epoetin alfa, 2.5 mg Albumin (Human), 5.8 mg sodium citrate, 5.8 mg sodium chloride, and 0.06 mg citric acid in Water for Injection, USP (pH 6.9 Â± 0.3). This formulation contains no preser
Physcial Appearance Sterile, colorless liquid in an isotonic sodium chloride/sodium citrate buffered solution or a sodium chloride/sodium phosphate buffered solution
Route of Administration Intravenous (Intravenous) or Subcutaneous (Subcuta
Recommended Dosage 100 units/kg subcutaneously or IV 3 times a week.
Contraindication Allergic
Side Effects Feeling light-headed, fainting, fever, chills, body aches, flu symptoms, sores in your mouth and throat, pale skin, feeling short of breath, rapid heart rate, trouble concentrating, easy bruising, unusual bleeding (nose, mouth, vagina, or rectum), purple or red pinpoint spots under your skin.
Useful Link http://www.procrit.com/
PubMed ID 20369312, 18208642
3-D Structure Th1013 (View) or (Download)

Primary information
ID 1096
ThPP ID Th1013
Therapeutic Peptide/Protein Name Epoetin alfa
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18396.1
Chemical Formula C815H1317N233O241S5
Isoelectric Point 8.75
Hydrophobicity N.A.
Melting Point (℃) 53
Half Life N.A.
Description It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Untreated or uncontrolled high blood pressure or if you have ever had pure red cell aplasia (PRCA, a type of anemia) caused by using darbepoetin alfa or epoetin alfa.
Side Effects Cold symptoms such as stuffy nose, sneezing, cough, sore throat, joint pain, bone pain, muscle pain, muscle spasm, dizziness, depression, mild headache, weight loss, sleep problems (insomnia), nausea, vomiting, trouble swallowing, pain or tenderness or irritation at the injection site.
Useful Link http://www.drugs.com/procrit.html
PubMed ID 20369312, 18208642
3-D Structure Th1013 (View) or (Download)

Primary information
ID 1097
ThPP ID Th1013
Therapeutic Peptide/Protein Name Epoetin alfa
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18396.1
Chemical Formula C815H1317N233O241S5
Isoelectric Point 8.75
Hydrophobicity N.A.
Melting Point (℃) 53
Half Life N.A.
Description It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.rxlist.com/procrit-drug.htm
PubMed ID 20369312, 18208642
3-D Structure Th1013 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

Primary information
ID	1071
ThPP ID	Th1013
Therapeutic Peptide/Protein Name	Epoetin alfa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18396.1
Chemical Formula	C815H1317N233O241S5
Isoelectric Point	8.75
Hydrophobicity	N.A.
Melting Point (℃)	53
Half Life	N.A.
Description	It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease	For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics	Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action	Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	20.2 Â± 15.9 mL/h/kg [150 Units/kg SC TIW, Week 1 when anemic cancer patients were receiving chemotherapy]
Categories	Hematinics
Patents Number	CA1339047
Date of Issue	27/05/97
Date of Expiry	27/05/14
Drug Interaction	N.A.
Target	Erythropoietin receptor
Information of corresponding available drug in the market
Brand Name	Binocrit
Company	Sandoz
Brand Discription	Binocrit is a solution administered as an injection. It is available in pre-filled syringes that contain 1,000-40,000 international units (IU) of the active substance, epoetin alfa
Prescribed for	Treatment of symptomatic anaemia associated with chronic renal failure (CRF) in adult and paediatric patients
Chemical Name	N.A.
Formulation	1000 IU/0.5 ml means that each ml of solution contains 2000 IU of epoetin alfa corresponding to 16.8 micrograms per ml. One pre-filled syringe of 0.5 ml contains 1000 international units (IU) corresponding to 8.4 micrograms epoetin alfa
Physcial Appearance	Clear colourless solution
Route of Administration	Subcutaneous and Intravenous infusion
Recommended Dosage	For less than 10 kg of weight usual maintainence dose is 75-150 (IU/kg given 3x/week). For 10-30 kg weight usual maintainence dose is 60-150 (IU/kg given 3x/week). For more than 30 kg weight usual maintainence dose is 30-100 (IU/kg given 3x/week).
Contraindication	Hypersensitivity, uncontrooled hypertension, Patients who develop Pure Red Cell Aplasia (PRCA) following treatment with any erythropoietin should not receive Binocrit, Patients who develop Pure Red Cell Aplasia (PRCA) following treatment with any erythropoetin.
Side Effects	The most frequent adverse reaction during treatment with epoetin alfa is a dose-dependent increase in blood pressure or aggravation of existing hypertension in cancer patients and in chronic renal failure patients.
Useful Link	https://www.medicines.org.uk/emc/medicine/21625
PubMed ID	20369312, 18208642
3-D Structure	Th1013 (View) or (Download)

Primary information
ID	1072
ThPP ID	Th1013
Therapeutic Peptide/Protein Name	Epoetin alfa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18396.1
Chemical Formula	C815H1317N233O241S5
Isoelectric Point	8.75
Hydrophobicity	N.A.
Melting Point (℃)	53
Half Life	N.A.
Description	It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease	For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics	Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action	Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	13.9 Â± 7.6 mL/h/kg [40,000 Units/kg SC TIW, Week 3 when anemic cancer patients were not receiving chemotherapy]
Categories	Anti-anemic Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Other common adverse reactions observed in clinical trials of epoetin alfa are deep vein thrombosis, influenza like illness, pyrexia, rash, pulmonary embolism, seizures, diarrhoea, nausea, headache, and vomiting. Influenza like illness including headaches
Useful Link	http://www.drugs.com/international/binocrit.html
PubMed ID	20369312, 18208642
3-D Structure	Th1013 (View) or (Download)

Primary information
ID	1073
ThPP ID	Th1013
Therapeutic Peptide/Protein Name	Epoetin alfa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18396.1
Chemical Formula	C815H1317N233O241S5
Isoelectric Point	8.75
Hydrophobicity	N.A.
Melting Point (℃)	53
Half Life	N.A.
Description	It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease	For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics	Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action	Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	23.6 Â± 9.5 mL/h/kg [150 Units/kg SC TIW, Week 3 when anemic cancer patients were not receiving chemotherapy]
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Epocept
Company	Lupin pharma
Brand Discription	N.A.
Prescribed for	To treat anaemia associated with chronic renal failure and cancer chemotherapy. Anaemia associated with Zidovudine therapy in AIDS patients can also be treated with it.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	Injection
Recommended Dosage	Starts with 25 to 50 i.u./kg over 1 to 2 minutes; thrice weekly. Increases the dosage in increments of 25 i.u./kg at intervals of four week.
Contraindication	Pregnancy and old age
Side Effects	Nausea, stomach upset, skin rashes and acute toxicity
Useful Link	http://www.medclik.com/General/pages/Drugmanual/BrandSearch/EPOCEPT.asp
PubMed ID	20369312, 18208642
3-D Structure	Th1013 (View) or (Download)

Primary information
ID	1074
ThPP ID	Th1013
Therapeutic Peptide/Protein Name	Epoetin alfa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18396.1
Chemical Formula	C815H1317N233O241S5
Isoelectric Point	8.75
Hydrophobicity	N.A.
Melting Point (℃)	53
Half Life	N.A.
Description	It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease	For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics	Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action	Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	9.2 Â± 4.7 mL/h/kg [40,000 Units/kg SC TIW, Week 1 when anemic cancer patients were receiving chemotherapy]
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Children
Side Effects	N.A.
Useful Link	http://kelo.in/drugs/lupin-limited/epocept-4000iu-inj-1ml/
PubMed ID	20369312, 18208642
3-D Structure	Th1013 (View) or (Download)

Primary information
ID	1075
ThPP ID	Th1013
Therapeutic Peptide/Protein Name	Epoetin alfa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18396.1
Chemical Formula	C815H1317N233O241S5
Isoelectric Point	8.75
Hydrophobicity	N.A.
Melting Point (℃)	53
Half Life	N.A.
Description	It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease	For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics	Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action	Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Epofit
Company	Intas pharma
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	20369312, 18208642
3-D Structure	Th1013 (View) or (Download)

Primary information
ID	1076
ThPP ID	Th1013
Therapeutic Peptide/Protein Name	Epoetin alfa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18396.1
Chemical Formula	C815H1317N233O241S5
Isoelectric Point	8.75
Hydrophobicity	N.A.
Melting Point (℃)	53
Half Life	N.A.
Description	It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease	For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics	Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action	Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Epogen
Company	Amgen Inc.
Brand Discription	Epogen(165-amino acid, 30,400 daltons) is an erythropoiesis-stimulating glycoprotein manufactured by recombinant DNA technology. It is produced by mammalian cells into which the human erythropoietin gene has been introduced. The product contains the ident
Prescribed for	Epogen is used to treat anemia in patients with chronic kidney disease. Epogen is also used in HIV patients who have anemia due to treatment with zidovudine and in cancer patients who have anemia due to chemotherapy.
Chemical Name	N.A.
Formulation	Each 1 mL vial contains 2000, 3000, 4000, or 10,000 Units of epoetin alfa, Albumin (Human) (2.5 mg), citric acid (0.06 mg), sodium chloride (5.9 mg), and sodium citrate (5.8 mg) in Water for Injection, USP (pH 6.9 Â± 0.3). Single-dose 1 mL vials formulated
Physcial Appearance	Sterile, colorless liquid
Route of Administration	Subcutaneous Injection
Recommended Dosage	N.A.
Contraindication	Allergic, untreated or uncontrolled high blood pressure; or if you have ever had pure red cell aplasia (PRCA, a type of anemia) caused by using darbepoetin alfa or epoetin alfa.
Side Effects	Feeling light-headed, fainting; fever, chills, body aches, flu symptoms, sores in your mouth and throat; pale skin, feeling short of breath, rapid heart rate, trouble concentrating; easy bruising, unusual bleeding (nose, mouth, vagina, or rectum), purple
Useful Link	http://www.drugs.com/epogen.html
PubMed ID	20369312, 18208642
3-D Structure	Th1013 (View) or (Download)

Primary information
ID	1077
ThPP ID	Th1013
Therapeutic Peptide/Protein Name	Epoetin alfa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18396.1
Chemical Formula	C815H1317N233O241S5
Isoelectric Point	8.75
Hydrophobicity	N.A.
Melting Point (℃)	53
Half Life	N.A.
Description	It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease	For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics	Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action	Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Cold symptoms such as stuffy nose, sneezing, cough, sore throat; joint pain, bone pain; muscle pain, muscle spasm; dizziness, depression, mild headache; weight loss; sleep problems (insomnia); nausea, vomiting, trouble swallowing; or pain or tenderness
Useful Link	http://www.drugs.com/drug-interactions/epoetin-alfa,epogen-index.html?filter=1
PubMed ID	20369312, 18208642
3-D Structure	Th1013 (View) or (Download)

Primary information
ID	1078
ThPP ID	Th1013
Therapeutic Peptide/Protein Name	Epoetin alfa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18396.1
Chemical Formula	C815H1317N233O241S5
Isoelectric Point	8.75
Hydrophobicity	N.A.
Melting Point (℃)	53
Half Life	N.A.
Description	It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease	For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics	Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action	Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Dangerously high blood pressure (severe headache, blurred vision, buzzing in your ears, anxiety, confusion, chest pain, shortness of breath, uneven heartbeats, seizure)
Useful Link	http://www.rxlist.com/epogen-drug.htm
PubMed ID	20369312, 18208642
3-D Structure	Th1013 (View) or (Download)

Primary information
ID	1079
ThPP ID	Th1013
Therapeutic Peptide/Protein Name	Epoetin alfa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18396.1
Chemical Formula	C815H1317N233O241S5
Isoelectric Point	8.75
Hydrophobicity	N.A.
Melting Point (℃)	53
Half Life	N.A.
Description	It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease	For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics	Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action	Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Epogin
Company	Chugai
Brand Discription	Epogin is a recombinant human erythropoetin
Prescribed for	EPOGIN Injection (EPOGIN Injection Syringe, EPOGIN Injection Ampule) has been widely used in the clinical settings for its approved indications of renal anemia under dialysis and before dialysis, immature infant anemia, and the autologous blood transfusio
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	Subcutaneous and Intravenous infusion
Recommended Dosage	The autologous blood transfusion, the intravenous administration of Epogin at 6000 units/per time for three times a week on alternative days has been already approved for three forms of â€œEpogin Injection 1500, 3000 and 6000.
Contraindication	N.A.
Side Effects	Nausea, fatigue, and vomiting.
Useful Link	http://www.chugai-pharm.co.jp/english/news/detail/20100618161500.html
PubMed ID	20369312, 18208642
3-D Structure	Th1013 (View) or (Download)

Primary information
ID	1080
ThPP ID	Th1013
Therapeutic Peptide/Protein Name	Epoetin alfa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18396.1
Chemical Formula	C815H1317N233O241S5
Isoelectric Point	8.75
Hydrophobicity	N.A.
Melting Point (℃)	53
Half Life	N.A.
Description	It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease	For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics	Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action	Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://kidneys.emedtv.com/epogen/epogin.html
PubMed ID	20369312, 18208642
3-D Structure	Th1013 (View) or (Download)

Primary information
ID	1081
ThPP ID	Th1013
Therapeutic Peptide/Protein Name	Epoetin alfa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18396.1
Chemical Formula	C815H1317N233O241S5
Isoelectric Point	8.75
Hydrophobicity	N.A.
Melting Point (℃)	53
Half Life	N.A.
Description	It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease	For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics	Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action	Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.firstwordpharma.com/node/419848#axzz3Hzwz2gXV
PubMed ID	20369312, 18208642
3-D Structure	Th1013 (View) or (Download)

Primary information
ID	1082
ThPP ID	Th1013
Therapeutic Peptide/Protein Name	Epoetin alfa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18396.1
Chemical Formula	C815H1317N233O241S5
Isoelectric Point	8.75
Hydrophobicity	N.A.
Melting Point (℃)	53
Half Life	N.A.
Description	It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease	For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics	Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action	Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Eprex
Company	Janssen-Cilag. Ortho Biologics LLC
Brand Discription	Eprex is synthetic erythropoietin and is used to replace the erythropoietin that is lacking in people who can't make enough, usually because their kidneys are not working properly.
Prescribed for	To treat patients with symptomatic or transfusion requiring anaemia associated with chronic renal failure to improve their quality of life.
Chemical Name	N.A.
Formulation	Each mL of sterile solution contains epoetin alfa 1,000 IU, 2,000 IU, 4,000 IU, 10,000 IU, or 40,000 IU. Nonmedicinal ingredients include glycine and polysorbate 80 as stabilizers, sodium chloride, sodium phosphate dibasic dihydrate, sodium phosphate mono
Physcial Appearance	Solution
Route of Administration	Subcutaneous and Intravenous infusion
Recommended Dosage	For children with chronic renal failure, the starting dose for anemia is 50 units (IU) per kilogram body weight, given 3 times a week. For adults with chronic renal failure, the starting dose for anemia is 50 to 100 units per kilogram of body weight.
Contraindication	Uncontrolled hypertension
Side Effects	Clotting of the vascular access site (for people on hemodialysis), dehydration, diarrhea, edema (swelling of the face, fingers, ankles, feet, or lower legs), headache, increased or decreased blood pressure, dizziness, or feeling faint, muscle aches and weakness.
Useful Link	https://www.janssen.com.au/files/Products/Eprex_PI.pdf?681ab03dec4d61f87c927b9559c69e7a
PubMed ID	20369312, 18208642
3-D Structure	Th1013 (View) or (Download)

Primary information
ID	1083
ThPP ID	Th1013
Therapeutic Peptide/Protein Name	Epoetin alfa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18396.1
Chemical Formula	C815H1317N233O241S5
Isoelectric Point	8.75
Hydrophobicity	N.A.
Melting Point (℃)	53
Half Life	N.A.
Description	It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease	For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics	Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action	Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	For treatment of anaemia and reduction of transfusion in patients with non-myeloid malignancies where anaemia develops as a result of concomitantly administered chemotherapy.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Known sensitivity to mammalian cell derived products
Side Effects	Signs of allergic reaction (symptoms may include skin rash or hives, trouble breathing, sweating, abnormal heart rate, or decreased blood pressure)
Useful Link	http://chealth.canoe.ca/drug_info_details.asp?channel_id=0&relation_id=0&brand_name_id=1174&page_no=2
PubMed ID	20369312, 18208642
3-D Structure	Th1013 (View) or (Download)

Primary information
ID	1084
ThPP ID	Th1013
Therapeutic Peptide/Protein Name	Epoetin alfa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18396.1
Chemical Formula	C815H1317N233O241S5
Isoelectric Point	8.75
Hydrophobicity	N.A.
Melting Point (℃)	53
Half Life	N.A.
Description	It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease	For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics	Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action	Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	In adult patients with mild-to-moderate anaemia (haemoglobin >10 to< 13g/dL) scheduled for elective surgery with an expected moderate blood loss (2-4 units or 900-1800mL) to reduce exposure to allogeneic blood transfusion and to facilitate erythropoietic
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Hypersensitivity to the active substance or to any of the excipients
Side Effects	Signs of blood clots (pain or swelling in the legs, worsening shortness of breath, coughing up blood)
Useful Link	N.A.
PubMed ID	20369312, 18208642
3-D Structure	Th1013 (View) or (Download)

Primary information
ID	1085
ThPP ID	Th1013
Therapeutic Peptide/Protein Name	Epoetin alfa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18396.1
Chemical Formula	C815H1317N233O241S5
Isoelectric Point	8.75
Hydrophobicity	N.A.
Melting Point (℃)	53
Half Life	N.A.
Description	It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease	For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics	Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action	Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	To augment autologous blood collection and to limit the decline in haemoglobin in anaemic adult patients who are scheduled for major elective surgery and who are not expected to pre-deposit their complete peri-operative blood needs.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Patients scheduled for elective surgery, who are not participating in an autologous blood pre-deposit programme and who have severe coronary, peripheral arterial, carotid or cerebral vascular disease, including patients with recent myocardial infarction or cerebral vascular accident.
Side Effects	Signs of stroke (confusion, severe headache, sudden weakness, dizziness, trouble speaking, or vision problems)
Useful Link	N.A.
PubMed ID	20369312, 18208642
3-D Structure	Th1013 (View) or (Download)

Primary information
ID	1086
ThPP ID	Th1013
Therapeutic Peptide/Protein Name	Epoetin alfa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18396.1
Chemical Formula	C815H1317N233O241S5
Isoelectric Point	8.75
Hydrophobicity	N.A.
Melting Point (℃)	53
Half Life	N.A.
Description	It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease	For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics	Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action	Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Surgery patients who for any reason cannot receive adequate antithrombotic prophylaxis or treatment.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	20369312, 18208642
3-D Structure	Th1013 (View) or (Download)

Primary information
ID	1087
ThPP ID	Th1013
Therapeutic Peptide/Protein Name	Epoetin alfa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18396.1
Chemical Formula	C815H1317N233O241S5
Isoelectric Point	8.75
Hydrophobicity	N.A.
Melting Point (℃)	53
Half Life	N.A.
Description	It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease	For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics	Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action	Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Patients who develop Pure Red Cell Aplasia (PRCA) following treatment with any erythropoietin should not receive EPREX or any other erythropoietin
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	20369312, 18208642
3-D Structure	Th1013 (View) or (Download)

Primary information
ID	1088
ThPP ID	Th1013
Therapeutic Peptide/Protein Name	Epoetin alfa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18396.1
Chemical Formula	C815H1317N233O241S5
Isoelectric Point	8.75
Hydrophobicity	N.A.
Melting Point (℃)	53
Half Life	N.A.
Description	It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease	For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics	Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action	Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Nanokine
Company	Nanogen Pharmaceutical biotechnology, Vietnam)
Brand Discription	NANOKINE is produced from raw, high purity material erythropoietin (EPO). Material EPO is produced by recombinant DNA techniques on ovarian cell lines marsupial cheeks of China (Chinese Hamster ovary, CHO). EPO gene coding for the protein was transferred
Prescribed for	Used in treatment of anaemia associated with chronic renal failure in paediatric and adult patients on haemodialysis and adult patients on peritoneal dialysis
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	Sterile, white, lyophilized powder. The reconstituted preparation with 1 ml solvent (containing 0.9% benzyl alcohol) results in a clear, colorless solution.
Route of Administration	Injection
Recommended Dosage	N.A.
Contraindication	Uncontrolled hypertension
Side Effects	N.A.
Useful Link	http://www.nanogenpharma.com/index.php?lang=en&com=product&act=detail&id=1#sthash.UbSsxMNf.dpuf
PubMed ID	20369312, 18208642
3-D Structure	Th1013 (View) or (Download)

Primary information
ID	1089
ThPP ID	Th1013
Therapeutic Peptide/Protein Name	Epoetin alfa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18396.1
Chemical Formula	C815H1317N233O241S5
Isoelectric Point	8.75
Hydrophobicity	N.A.
Melting Point (℃)	53
Half Life	N.A.
Description	It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease	For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics	Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action	Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	To treat severe anaemia of renal origin accompanied by clinical symptoms in adult patients with renal insufficiency not yet undergoing dialysis.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Develop pure red cell aplasia (PRCA) following treatment with erythropoietin
Side Effects	N.A.
Useful Link	http://www.nanogenpharma.com/index.php?lang=en&com=product&act=detail&id=1
PubMed ID	20369312, 18208642
3-D Structure	Th1013 (View) or (Download)

Primary information
ID	1090
ThPP ID	Th1013
Therapeutic Peptide/Protein Name	Epoetin alfa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18396.1
Chemical Formula	C815H1317N233O241S5
Isoelectric Point	8.75
Hydrophobicity	N.A.
Melting Point (℃)	53
Half Life	N.A.
Description	It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease	For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics	Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action	Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Hypersensitivity to the active substance or to any of the excipients.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	20369312, 18208642
3-D Structure	Th1013 (View) or (Download)

Updated version of this database is available at ThpDB2

Detailed description page of THPdb

Primary information
ID	1091
ThPP ID	Th1013
Therapeutic Peptide/Protein Name	Epoetin alfa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18396.1
Chemical Formula	C815H1317N233O241S5
Isoelectric Point	8.75
Hydrophobicity	N.A.
Melting Point (℃)	53
Half Life	N.A.
Description	It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease	For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics	Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action	Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Have surgery and cannot receive adequate antithrombotic prophylaxis for any reason.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	20369312, 18208642
3-D Structure	Th1013 (View) or (Download)

Primary information
ID	1092
ThPP ID	Th1013
Therapeutic Peptide/Protein Name	Epoetin alfa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18396.1
Chemical Formula	C815H1317N233O241S5
Isoelectric Point	8.75
Hydrophobicity	N.A.
Melting Point (℃)	53
Half Life	N.A.
Description	It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease	For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics	Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action	Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Have autologous blood predonation programmes
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	20369312, 18208642
3-D Structure	Th1013 (View) or (Download)

Primary information
ID	1093
ThPP ID	Th1013
Therapeutic Peptide/Protein Name	Epoetin alfa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18396.1
Chemical Formula	C815H1317N233O241S5
Isoelectric Point	8.75
Hydrophobicity	N.A.
Melting Point (℃)	53
Half Life	N.A.
Description	It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease	For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics	Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action	Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Are scheduled for major elective orthopaedic surgery and not participating in an autologous blood predonation
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	20369312, 18208642
3-D Structure	Th1013 (View) or (Download)

Primary information
ID	1094
ThPP ID	Th1013
Therapeutic Peptide/Protein Name	Epoetin alfa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18396.1
Chemical Formula	C815H1317N233O241S5
Isoelectric Point	8.75
Hydrophobicity	N.A.
Melting Point (℃)	53
Half Life	N.A.
Description	It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease	For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics	Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action	Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Suffer severe coronary, peripheral arterial, carotid or cerebral vascular disease, including patients with recent myocardial infarction or cerebral vascular accident.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	20369312, 18208642
3-D Structure	Th1013 (View) or (Download)

Primary information
ID	1095
ThPP ID	Th1013
Therapeutic Peptide/Protein Name	Epoetin alfa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18396.1
Chemical Formula	C815H1317N233O241S5
Isoelectric Point	8.75
Hydrophobicity	N.A.
Melting Point (℃)	53
Half Life	N.A.
Description	It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease	For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics	Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action	Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Procrit
Company	Ortho Biotech
Brand Discription	PROCRIT(165 amino acid, 30,400 daltons) is a glycoprotein manufactured by recombinant DNA technology having the same biological effects as endogenous erythropoietin.It is produced by mammalian cells into which the human erythropoietin gene has been introd
Prescribed for	Used to treat anemia in patients with Chronic Kidney Disease (CKD). Procrit is also used to treat anemia caused by zidovudine in HIV-infected patients and in certain patients receiving chemotherapy.
Chemical Name	N.A.
Formulation	Each 1 mL of solution contains 2000, 3000, 4000 or 10,000 Units of Epoetin alfa, 2.5 mg Albumin (Human), 5.8 mg sodium citrate, 5.8 mg sodium chloride, and 0.06 mg citric acid in Water for Injection, USP (pH 6.9 Â± 0.3). This formulation contains no preser
Physcial Appearance	Sterile, colorless liquid in an isotonic sodium chloride/sodium citrate buffered solution or a sodium chloride/sodium phosphate buffered solution
Route of Administration	Intravenous (Intravenous) or Subcutaneous (Subcuta
Recommended Dosage	100 units/kg subcutaneously or IV 3 times a week.
Contraindication	Allergic
Side Effects	Feeling light-headed, fainting, fever, chills, body aches, flu symptoms, sores in your mouth and throat, pale skin, feeling short of breath, rapid heart rate, trouble concentrating, easy bruising, unusual bleeding (nose, mouth, vagina, or rectum), purple or red pinpoint spots under your skin.
Useful Link	http://www.procrit.com/
PubMed ID	20369312, 18208642
3-D Structure	Th1013 (View) or (Download)

Primary information
ID	1096
ThPP ID	Th1013
Therapeutic Peptide/Protein Name	Epoetin alfa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18396.1
Chemical Formula	C815H1317N233O241S5
Isoelectric Point	8.75
Hydrophobicity	N.A.
Melting Point (℃)	53
Half Life	N.A.
Description	It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease	For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics	Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action	Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Untreated or uncontrolled high blood pressure or if you have ever had pure red cell aplasia (PRCA, a type of anemia) caused by using darbepoetin alfa or epoetin alfa.
Side Effects	Cold symptoms such as stuffy nose, sneezing, cough, sore throat, joint pain, bone pain, muscle pain, muscle spasm, dizziness, depression, mild headache, weight loss, sleep problems (insomnia), nausea, vomiting, trouble swallowing, pain or tenderness or irritation at the injection site.
Useful Link	http://www.drugs.com/procrit.html
PubMed ID	20369312, 18208642
3-D Structure	Th1013 (View) or (Download)

Primary information
ID	1097
ThPP ID	Th1013
Therapeutic Peptide/Protein Name	Epoetin alfa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18396.1
Chemical Formula	C815H1317N233O241S5
Isoelectric Point	8.75
Hydrophobicity	N.A.
Melting Point (℃)	53
Half Life	N.A.
Description	It is recombinant human erythropoietin which is produced by CHO cells.
Indication/Disease	For treatment of anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics	Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action	Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.rxlist.com/procrit-drug.htm
PubMed ID	20369312, 18208642
3-D Structure	Th1013 (View) or (Download)