Detailed description page of THPdb

This page displays user query in tabular form.

Th1011 details

Primary information
ID 1064
ThPP ID Th1011
Therapeutic Peptide/Protein Name Darbepoetin alfa
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18396.1
Chemical Formula C815H1317N233O241S5
Isoelectric Point 8.75
Hydrophobicity -0.188
Melting Point (℃) 53
Half Life N.A.
Description Human erythropoietin with 2 amino acid substitutions to enhance glycosylation (5 N-linked chains), 165 residues (MW 37kD) produced in CHO cells by recombinant DNA technology.
Indication/Disease For treating anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics Darbepoetin alfa is used in treating anemia. It is involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action Darbepoetin alfa stimulates erythropoiesis by the same mechanism as endogenous erythropoietin, it interacts with progenitor stem cells to increase red cell production. Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Anti-anemic Agents
Patents Number CA2165694
Date of Issue 18/03/03
Date of Expiry 15/10/10
Drug Interaction N.A.
Target Erythropoietin receptor
Information of corresponding available drug in the market
Brand Name Aranesp
Company Amgen Inc
Brand Discription Aranesp is an erythropoiesis-stimulating protein that is produced in Chinese hamster ovary cells by recombinant DNA technology. Aranesp is a 165-amino acid protein (37,000 daltons) that differs from recombinant human erythropoietin in containing 5 N-linke
Prescribed for Used to treat anemia.
Chemical Name N.A.
Formulation Each 1 mL contains polysorbate 80 (0.05 mg), sodium chloride (8.18 mg), sodium phosphate dibasic anhydrous (0.66 mg), and sodium phosphate monobasic monohydrate (2.12 mg) in Water for Injection, USP (pH 6.2 Â± 0.2).
Physcial Appearance Sterile, colorless, preservative-free solution containing polysorbate
Route of Administration Intravenous or Subcutaneous administration
Recommended Dosage N.A.
Contraindication Allergic
Side Effects Fever, chills, body aches, flu symptoms; feeling like you might pass out; easy bruising, unusual bleeding (nose, mouth, vagina, or rectum), purple or red pinpoint spots under your skin; seizure (black-out or convulsions); or dangerously high blood pressure.
Useful Link http://www.aranesp.com/
PubMed ID 23847411, 23338536, 23325012, 23243269, 22803621, 22192713, 20140276, 18837016, 16179960
3-D Structure Th1011 (View) or (Download)

Primary information
ID 1065
ThPP ID Th1011
Therapeutic Peptide/Protein Name Darbepoetin alfa
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18396.1
Chemical Formula C815H1317N233O241S5
Isoelectric Point 8.75
Hydrophobicity -0.188
Melting Point (℃) 53
Half Life N.A.
Description Human erythropoietin with 2 amino acid substitutions to enhance glycosylation (5 N-linked chains), 165 residues (MW 37kD) produced in CHO cells by recombinant DNA technology.
Indication/Disease For treating anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics Darbepoetin alfa is used in treating anemia. It is involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action Darbepoetin alfa stimulates erythropoiesis by the same mechanism as endogenous erythropoietin, it interacts with progenitor stem cells to increase red cell production. Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Hematinics
Patents Number CA2147124
Date of Issue 05/11/02
Date of Expiry 16/08/14
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Untreated or uncontrolled high blood pressure or have ever had pure red cell aplasia caused by using darbepoetin alfa or epoetin alfa.
Side Effects Severe headache, blurred vision, buzzing in your ears, anxiety, confusion, chest pain, shortness of breath, uneven heartbeats, seizure, stomach pain; mild cough; mild skin rash or redness; or pain, bruising, swelling, warmth, redness, oozing, or bleeding.
Useful Link http://www.rxlist.com/aranesp-drug.htm
PubMed ID 23847411, 23338536, 23325012, 23243269, 22803621, 22192713, 20140276, 18837016, 16179960
3-D Structure Th1011 (View) or (Download)

Primary information
ID 1066
ThPP ID Th1011
Therapeutic Peptide/Protein Name Darbepoetin alfa
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18396.1
Chemical Formula C815H1317N233O241S5
Isoelectric Point 8.75
Hydrophobicity -0.188
Melting Point (℃) 53
Half Life N.A.
Description Human erythropoietin with 2 amino acid substitutions to enhance glycosylation (5 N-linked chains), 165 residues (MW 37kD) produced in CHO cells by recombinant DNA technology.
Indication/Disease For treating anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics Darbepoetin alfa is used in treating anemia. It is involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action Darbepoetin alfa stimulates erythropoiesis by the same mechanism as endogenous erythropoietin, it interacts with progenitor stem cells to increase red cell production. Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.drugs.com/aranesp.html
PubMed ID 23847411, 23338536, 23325012, 23243269, 22803621, 22192713, 20140276, 18837016, 16179960
3-D Structure Th1011 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

Primary information
ID	1064
ThPP ID	Th1011
Therapeutic Peptide/Protein Name	Darbepoetin alfa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18396.1
Chemical Formula	C815H1317N233O241S5
Isoelectric Point	8.75
Hydrophobicity	-0.188
Melting Point (℃)	53
Half Life	N.A.
Description	Human erythropoietin with 2 amino acid substitutions to enhance glycosylation (5 N-linked chains), 165 residues (MW 37kD) produced in CHO cells by recombinant DNA technology.
Indication/Disease	For treating anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics	Darbepoetin alfa is used in treating anemia. It is involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action	Darbepoetin alfa stimulates erythropoiesis by the same mechanism as endogenous erythropoietin, it interacts with progenitor stem cells to increase red cell production. Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Anti-anemic Agents
Patents Number	CA2165694
Date of Issue	18/03/03
Date of Expiry	15/10/10
Drug Interaction	N.A.
Target	Erythropoietin receptor
Information of corresponding available drug in the market
Brand Name	Aranesp
Company	Amgen Inc
Brand Discription	Aranesp is an erythropoiesis-stimulating protein that is produced in Chinese hamster ovary cells by recombinant DNA technology. Aranesp is a 165-amino acid protein (37,000 daltons) that differs from recombinant human erythropoietin in containing 5 N-linke
Prescribed for	Used to treat anemia.
Chemical Name	N.A.
Formulation	Each 1 mL contains polysorbate 80 (0.05 mg), sodium chloride (8.18 mg), sodium phosphate dibasic anhydrous (0.66 mg), and sodium phosphate monobasic monohydrate (2.12 mg) in Water for Injection, USP (pH 6.2 Â± 0.2).
Physcial Appearance	Sterile, colorless, preservative-free solution containing polysorbate
Route of Administration	Intravenous or Subcutaneous administration
Recommended Dosage	N.A.
Contraindication	Allergic
Side Effects	Fever, chills, body aches, flu symptoms; feeling like you might pass out; easy bruising, unusual bleeding (nose, mouth, vagina, or rectum), purple or red pinpoint spots under your skin; seizure (black-out or convulsions); or dangerously high blood pressure.
Useful Link	http://www.aranesp.com/
PubMed ID	23847411, 23338536, 23325012, 23243269, 22803621, 22192713, 20140276, 18837016, 16179960
3-D Structure	Th1011 (View) or (Download)

Primary information
ID	1065
ThPP ID	Th1011
Therapeutic Peptide/Protein Name	Darbepoetin alfa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18396.1
Chemical Formula	C815H1317N233O241S5
Isoelectric Point	8.75
Hydrophobicity	-0.188
Melting Point (℃)	53
Half Life	N.A.
Description	Human erythropoietin with 2 amino acid substitutions to enhance glycosylation (5 N-linked chains), 165 residues (MW 37kD) produced in CHO cells by recombinant DNA technology.
Indication/Disease	For treating anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics	Darbepoetin alfa is used in treating anemia. It is involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action	Darbepoetin alfa stimulates erythropoiesis by the same mechanism as endogenous erythropoietin, it interacts with progenitor stem cells to increase red cell production. Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Hematinics
Patents Number	CA2147124
Date of Issue	05/11/02
Date of Expiry	16/08/14
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Untreated or uncontrolled high blood pressure or have ever had pure red cell aplasia caused by using darbepoetin alfa or epoetin alfa.
Side Effects	Severe headache, blurred vision, buzzing in your ears, anxiety, confusion, chest pain, shortness of breath, uneven heartbeats, seizure, stomach pain; mild cough; mild skin rash or redness; or pain, bruising, swelling, warmth, redness, oozing, or bleeding.
Useful Link	http://www.rxlist.com/aranesp-drug.htm
PubMed ID	23847411, 23338536, 23325012, 23243269, 22803621, 22192713, 20140276, 18837016, 16179960
3-D Structure	Th1011 (View) or (Download)

Primary information
ID	1066
ThPP ID	Th1011
Therapeutic Peptide/Protein Name	Darbepoetin alfa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18396.1
Chemical Formula	C815H1317N233O241S5
Isoelectric Point	8.75
Hydrophobicity	-0.188
Melting Point (℃)	53
Half Life	N.A.
Description	Human erythropoietin with 2 amino acid substitutions to enhance glycosylation (5 N-linked chains), 165 residues (MW 37kD) produced in CHO cells by recombinant DNA technology.
Indication/Disease	For treating anemia (from renal transplants or certain HIV treatment).
Pharmacodynamics	Darbepoetin alfa is used in treating anemia. It is involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of Action	Darbepoetin alfa stimulates erythropoiesis by the same mechanism as endogenous erythropoietin, it interacts with progenitor stem cells to increase red cell production. Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.drugs.com/aranesp.html
PubMed ID	23847411, 23338536, 23325012, 23243269, 22803621, 22192713, 20140276, 18837016, 16179960
3-D Structure	Th1011 (View) or (Download)

Updated version of this database is available at ThpDB2

Detailed description page of THPdb