Detailed description page of THPdb

This page displays user query in tabular form.

Th1010 details

Primary information
ID 1059
ThPP ID Th1010
Therapeutic Peptide/Protein Name Interferon alfa-n1
Sequence CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 19241.1
Chemical Formula C860H1353N227O255S9
Isoelectric Point 5.99
Hydrophobicity -0.336
Melting Point (℃) 61
Half Life 1.2 hours (mammalian reticulocytes, in vitro)
Description Purified, natural and glycosylated human interferon alpha proteins of 166 residues.
Indication/Disease Used to treat venereal or genital warts caused by the Human Papiloma Virus.
Pharmacodynamics Upregulates the expression of MHC I proteins, allowing increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2-5-oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of Action Interferon alpha binds to type I interferon receptors namely IFNAR1 and IFNAR2c which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Antiviral Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Interferon increases the effect and toxicity of theophylline
Target Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Information of corresponding available drug in the market
Brand Name Wellferon
Company GlaxoSmithKline
Brand Discription Wellferon is a purified blend of natural human alpha interferons which are obtained from human lympho-blastoid cells following induction with Sendai virus. Wellferon resembles human leukocyte interferon as it is a mixture of natural alpha subtypes but dif
Prescribed for Used for the treatment of patients with hairy cell leukemia, juvenile laryngeal papillomatosis, condylomata acuminata, chronic hepatitis B and chronic hepatitis C infections.
Chemical Name N.A.
Formulation Each vial of clear, colorless solution contains interferon alpha-n1 (lns) [purified human lymphoblastoid interferon] 3, 5 or 10 mega units. 1 mega unit (Mu)=1Â´10International Units (IU) of lymphoblastoid interferon. Formulated in 1 mL tris-glycine buffere
Physcial Appearance Solution
Route of Administration Injection
Recommended Dosage N.A.
Contraindication Hypersensitivity
Side Effects Most side/adverse effects, except the flu-like syndrome, are dose-related . They are usually mild to moderate at systemic doses less than 10 million Units per day }; hematologic and hepatic toxicities tend to be more frequent with doses above 10 million
Useful Link http://www.drugs.com/mmx/wellferon.html
PubMed ID 9537453, 9305672, 1861694, 2016626, 3046638, 3170795, 3278186, 3488481, 3016426
3-D Structure Th1010 (View) or (Download)

Primary information
ID 1060
ThPP ID Th1010
Therapeutic Peptide/Protein Name Interferon alfa-n1
Sequence CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 19241.1
Chemical Formula C860H1353N227O255S9
Isoelectric Point 5.99
Hydrophobicity -0.336
Melting Point (℃) 61
Half Life 20 hours (yeast, in vivo)
Description Purified, natural and glycosylated human interferon alpha proteins of 166 residues.
Indication/Disease Used to treat venereal or genital warts caused by the Human Papiloma Virus.
Pharmacodynamics Upregulates the expression of MHC I proteins, allowing increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2-5-oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of Action Interferon alpha binds to type I interferon receptors namely IFNAR1 and IFNAR2c which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Immunologic Factors
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Aminophylline
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Reduced blood pressure occurs frequently with systemic use but is rarely symptomatic ; hypotension may occur during administration or up to two days after therapy, and may require supportive therapy including fluid replacement to maintain intravascular v
Useful Link http://www.rxmed.com/b.main/b2.pharmaceutical/b2.1.monographs/CPS-%20Monographs/CPS-%20%28General%20Monographs-%20W%29/WELLFERON.html
PubMed ID 9537453, 9305672, 1861694, 2016626, 3046638, 3170795, 3278186, 3488481, 3016426
3-D Structure Th1010 (View) or (Download)

Primary information
ID 1061
ThPP ID Th1010
Therapeutic Peptide/Protein Name Interferon alfa-n1
Sequence CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 19241.1
Chemical Formula C860H1353N227O255S9
Isoelectric Point 5.99
Hydrophobicity -0.336
Melting Point (℃) 61
Half Life 10 hours (Escherichia coli, in vivo)
Description Purified, natural and glycosylated human interferon alpha proteins of 166 residues.
Indication/Disease Used to treat venereal or genital warts caused by the Human Papiloma Virus.
Pharmacodynamics Upregulates the expression of MHC I proteins, allowing increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2-5-oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of Action Interferon alpha binds to type I interferon receptors namely IFNAR1 and IFNAR2c which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Immunosuppressive Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Dyphylline
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Development of neutralizing antibodies has been reported. Relationship of the presence of neutralizing antibodies to loss of antitumor effects is controversial; a possible correlation with titer of neutralizing antibodies has been suggested but not confirmed.
Useful Link N.A.
PubMed ID 9537453, 9305672, 1861694, 2016626, 3046638, 3170795, 3278186, 3488481, 3016426
3-D Structure Th1010 (View) or (Download)

Primary information
ID 1062
ThPP ID Th1010
Therapeutic Peptide/Protein Name Interferon alfa-n1
Sequence CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 19241.1
Chemical Formula C860H1353N227O255S9
Isoelectric Point 5.99
Hydrophobicity -0.336
Melting Point (℃) 61
Half Life N.A.
Description Purified, natural and glycosylated human interferon alpha proteins of 166 residues.
Indication/Disease Used to treat venereal or genital warts caused by the Human Papiloma Virus.
Pharmacodynamics Upregulates the expression of MHC I proteins, allowing increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2-5-oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of Action Interferon alpha binds to type I interferon receptors namely IFNAR1 and IFNAR2c which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Oxtriphylline
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 9537453, 9305672, 1861694, 2016626, 3046638, 3170795, 3278186, 3488481, 3016426
3-D Structure Th1010 (View) or (Download)

Primary information
ID 1063
ThPP ID Th1010
Therapeutic Peptide/Protein Name Interferon alfa-n1
Sequence CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 19241.1
Chemical Formula C860H1353N227O255S9
Isoelectric Point 5.99
Hydrophobicity -0.336
Melting Point (℃) 61
Half Life N.A.
Description Purified, natural and glycosylated human interferon alpha proteins of 166 residues.
Indication/Disease Used to treat venereal or genital warts caused by the Human Papiloma Virus.
Pharmacodynamics Upregulates the expression of MHC I proteins, allowing increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2-5-oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of Action Interferon alpha binds to type I interferon receptors namely IFNAR1 and IFNAR2c which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 9537453, 9305672, 1861694, 2016626, 3046638, 3170795, 3278186, 3488481, 3016426
3-D Structure Th1010 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

Primary information
ID	1059
ThPP ID	Th1010
Therapeutic Peptide/Protein Name	Interferon alfa-n1
Sequence	CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	19241.1
Chemical Formula	C860H1353N227O255S9
Isoelectric Point	5.99
Hydrophobicity	-0.336
Melting Point (℃)	61
Half Life	1.2 hours (mammalian reticulocytes, in vitro)
Description	Purified, natural and glycosylated human interferon alpha proteins of 166 residues.
Indication/Disease	Used to treat venereal or genital warts caused by the Human Papiloma Virus.
Pharmacodynamics	Upregulates the expression of MHC I proteins, allowing increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2-5-oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of Action	Interferon alpha binds to type I interferon receptors namely IFNAR1 and IFNAR2c which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Antiviral Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Interferon increases the effect and toxicity of theophylline
Target	Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Information of corresponding available drug in the market
Brand Name	Wellferon
Company	GlaxoSmithKline
Brand Discription	Wellferon is a purified blend of natural human alpha interferons which are obtained from human lympho-blastoid cells following induction with Sendai virus. Wellferon resembles human leukocyte interferon as it is a mixture of natural alpha subtypes but dif
Prescribed for	Used for the treatment of patients with hairy cell leukemia, juvenile laryngeal papillomatosis, condylomata acuminata, chronic hepatitis B and chronic hepatitis C infections.
Chemical Name	N.A.
Formulation	Each vial of clear, colorless solution contains interferon alpha-n1 (lns) [purified human lymphoblastoid interferon] 3, 5 or 10 mega units. 1 mega unit (Mu)=1Â´10International Units (IU) of lymphoblastoid interferon. Formulated in 1 mL tris-glycine buffere
Physcial Appearance	Solution
Route of Administration	Injection
Recommended Dosage	N.A.
Contraindication	Hypersensitivity
Side Effects	Most side/adverse effects, except the flu-like syndrome, are dose-related . They are usually mild to moderate at systemic doses less than 10 million Units per day }; hematologic and hepatic toxicities tend to be more frequent with doses above 10 million
Useful Link	http://www.drugs.com/mmx/wellferon.html
PubMed ID	9537453, 9305672, 1861694, 2016626, 3046638, 3170795, 3278186, 3488481, 3016426
3-D Structure	Th1010 (View) or (Download)

Primary information
ID	1060
ThPP ID	Th1010
Therapeutic Peptide/Protein Name	Interferon alfa-n1
Sequence	CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	19241.1
Chemical Formula	C860H1353N227O255S9
Isoelectric Point	5.99
Hydrophobicity	-0.336
Melting Point (℃)	61
Half Life	20 hours (yeast, in vivo)
Description	Purified, natural and glycosylated human interferon alpha proteins of 166 residues.
Indication/Disease	Used to treat venereal or genital warts caused by the Human Papiloma Virus.
Pharmacodynamics	Upregulates the expression of MHC I proteins, allowing increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2-5-oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of Action	Interferon alpha binds to type I interferon receptors namely IFNAR1 and IFNAR2c which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Immunologic Factors
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Aminophylline
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Reduced blood pressure occurs frequently with systemic use but is rarely symptomatic ; hypotension may occur during administration or up to two days after therapy, and may require supportive therapy including fluid replacement to maintain intravascular v
Useful Link	http://www.rxmed.com/b.main/b2.pharmaceutical/b2.1.monographs/CPS-%20Monographs/CPS-%20%28General%20Monographs-%20W%29/WELLFERON.html
PubMed ID	9537453, 9305672, 1861694, 2016626, 3046638, 3170795, 3278186, 3488481, 3016426
3-D Structure	Th1010 (View) or (Download)

Primary information
ID	1061
ThPP ID	Th1010
Therapeutic Peptide/Protein Name	Interferon alfa-n1
Sequence	CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	19241.1
Chemical Formula	C860H1353N227O255S9
Isoelectric Point	5.99
Hydrophobicity	-0.336
Melting Point (℃)	61
Half Life	10 hours (Escherichia coli, in vivo)
Description	Purified, natural and glycosylated human interferon alpha proteins of 166 residues.
Indication/Disease	Used to treat venereal or genital warts caused by the Human Papiloma Virus.
Pharmacodynamics	Upregulates the expression of MHC I proteins, allowing increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2-5-oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of Action	Interferon alpha binds to type I interferon receptors namely IFNAR1 and IFNAR2c which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Immunosuppressive Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Dyphylline
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Development of neutralizing antibodies has been reported. Relationship of the presence of neutralizing antibodies to loss of antitumor effects is controversial; a possible correlation with titer of neutralizing antibodies has been suggested but not confirmed.
Useful Link	N.A.
PubMed ID	9537453, 9305672, 1861694, 2016626, 3046638, 3170795, 3278186, 3488481, 3016426
3-D Structure	Th1010 (View) or (Download)

Primary information
ID	1062
ThPP ID	Th1010
Therapeutic Peptide/Protein Name	Interferon alfa-n1
Sequence	CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	19241.1
Chemical Formula	C860H1353N227O255S9
Isoelectric Point	5.99
Hydrophobicity	-0.336
Melting Point (℃)	61
Half Life	N.A.
Description	Purified, natural and glycosylated human interferon alpha proteins of 166 residues.
Indication/Disease	Used to treat venereal or genital warts caused by the Human Papiloma Virus.
Pharmacodynamics	Upregulates the expression of MHC I proteins, allowing increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2-5-oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of Action	Interferon alpha binds to type I interferon receptors namely IFNAR1 and IFNAR2c which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Oxtriphylline
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	9537453, 9305672, 1861694, 2016626, 3046638, 3170795, 3278186, 3488481, 3016426
3-D Structure	Th1010 (View) or (Download)

Primary information
ID	1063
ThPP ID	Th1010
Therapeutic Peptide/Protein Name	Interferon alfa-n1
Sequence	CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	19241.1
Chemical Formula	C860H1353N227O255S9
Isoelectric Point	5.99
Hydrophobicity	-0.336
Melting Point (℃)	61
Half Life	N.A.
Description	Purified, natural and glycosylated human interferon alpha proteins of 166 residues.
Indication/Disease	Used to treat venereal or genital warts caused by the Human Papiloma Virus.
Pharmacodynamics	Upregulates the expression of MHC I proteins, allowing increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2-5-oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of Action	Interferon alpha binds to type I interferon receptors namely IFNAR1 and IFNAR2c which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	9537453, 9305672, 1861694, 2016626, 3046638, 3170795, 3278186, 3488481, 3016426
3-D Structure	Th1010 (View) or (Download)