Detailed description page of THPdb

This page displays user query in tabular form.

Th1009 details

Primary information
ID 1055
ThPP ID Th1009
Therapeutic Peptide/Protein Name Alteplase
Sequence SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS view full sequnce in fasta
Functional Classification Ib
Molecular Weight 59042.3
Chemical Formula C2569H3928N746O781S40
Isoelectric Point 7.61
Hydrophobicity -0.516
Melting Point (℃) 60
Half Life N.A.
Description Glycosylated, human tissue plasminogen activator of 527 residues purified from CHO cells.
Indication/Disease To manage acute myocardial infarction, acute ischemic stroke and for lysis of acute pulmonary emboli
Pharmacodynamics Alteplase binds to fibrin in a thrombus and converts the entrapped plasminogen to plasmin, thus limited conversion of plasminogen takes place in the absence of fibrin.
Mechanism of Action Alteplase on binding to fibrin rich clots via the fibronectin finger-like domain and the Kringle 2 domain cleaves (domain) the Arg/Val bond in plasminogen to form plasmin which in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Thrombolytic Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Ginkgo biloba.Additive anticoagulant/antiplatelet effects may increase bleeding risk. Concomitant therapy should be avoided.
Target Plasminogen,Fibrinogen alpha chain,Urokinase plasminogen activator surface receptor,Plasminogen activator inhibitor 1
Information of corresponding available drug in the market
Brand Name Activase
Company Genentech Inc
Brand Discription Activase is a tissue plasminogen activator produced by recombinant DNA technology. It is a sterile, purified glycoprotein of 527 amino acids, synthesized using the complementary DNA (cDNA) for natural human tissue-type plasminogen activator obtained from
Prescribed for To treat blood clots in the lungs and improve heart function and survival followed by a heart attack. Activase may also be used to improve recovery and reduce disability in certain patients who have suffered from a stroke.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance Sterile, white to off-white, lyophilized powder
Route of Administration Intravenous
Recommended Dosage The recommended dose is not to exceed 100 mg. Patients weighing > 67 kg are recommended a dose of 100 mg as a 15 mg intravenous bolus, followed by 50 mg infused over the next 30 minutes, and then 35 mg infused over the next 60 minutes.
Contraindication Allergic
Side Effects Rash; hives; difficulty breathing; tightness in the chest; swelling of the mouth, face, lips, or tongue.
Useful Link http://www.drugs.com/cdi/activase.html
PubMed ID 15650539
3-D Structure Th1009 (View) or (Download)

Primary information
ID 1056
ThPP ID Th1009
Therapeutic Peptide/Protein Name Alteplase
Sequence SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS view full sequnce in fasta
Functional Classification Ib
Molecular Weight 59042.3
Chemical Formula C2569H3928N746O781S40
Isoelectric Point 7.61
Hydrophobicity -0.516
Melting Point (℃) 60
Half Life N.A.
Description Glycosylated, human tissue plasminogen activator of 527 residues purified from CHO cells.
Indication/Disease To manage acute myocardial infarction, acute ischemic stroke and for lysis of acute pulmonary emboli
Pharmacodynamics Alteplase binds to fibrin in a thrombus and converts the entrapped plasminogen to plasmin, thus limited conversion of plasminogen takes place in the absence of fibrin.
Mechanism of Action Alteplase on binding to fibrin rich clots via the fibronectin finger-like domain and the Kringle 2 domain cleaves (domain) the Arg/Val bond in plasminogen to form plasmin which in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Thrombolytic Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction IV nitroglycerin may decrease the effect of alteplase.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Have active internal bleeding, history of stroke, recent brain or spinal surgery (within 3 months), a growth in the brain, abnormal formation of blood vessels.
Side Effects Black or bloody stools; bloody vomit; change in color of your fingers or toes; changes in vision; chills; coughing up blood; decreased amount of urine produced; difficulty breathing or sudden shortness of breath; difficulty swallowing.
Useful Link http://www.rxlist.com/activase-drug.htm
PubMed ID 15650539
3-D Structure Th1009 (View) or (Download)

Primary information
ID 1057
ThPP ID Th1009
Therapeutic Peptide/Protein Name Alteplase
Sequence SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS view full sequnce in fasta
Functional Classification Ib
Molecular Weight 59042.3
Chemical Formula C2569H3928N746O781S40
Isoelectric Point 7.61
Hydrophobicity -0.516
Melting Point (℃) 60
Half Life N.A.
Description Glycosylated, human tissue plasminogen activator of 527 residues purified from CHO cells.
Indication/Disease To manage acute myocardial infarction, acute ischemic stroke and for lysis of acute pulmonary emboli
Pharmacodynamics Alteplase binds to fibrin in a thrombus and converts the entrapped plasminogen to plasmin, thus limited conversion of plasminogen takes place in the absence of fibrin.
Mechanism of Action Alteplase on binding to fibrin rich clots via the fibronectin finger-like domain and the Kringle 2 domain cleaves (domain) the Arg/Val bond in plasminogen to form plasmin which in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Thrombolytic Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Ticlopidine.Increased bleeding risk. Monitor for signs of bleeding.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Certain type of bulging blood vessel (aneurysm), have a heart attack or blood clot in the lung and you also have had recent brain or spinal injury
Side Effects Numbness in arm or leg; one-sided weakness; pain, redness, or swelling at the injection site; purple skin color; rectal bleeding; seizures; severe bleeding; severe muscle aches or pain; severe stomach pain; sharp or crushing chest pain; speech problems
Useful Link http://www.drugs.com/drug-interactions/alteplase,activase-index.html?filter=1
PubMed ID 15650539
3-D Structure Th1009 (View) or (Download)

Primary information
ID 1058
ThPP ID Th1009
Therapeutic Peptide/Protein Name Alteplase
Sequence SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS view full sequnce in fasta
Functional Classification Ib
Molecular Weight 59042.3
Chemical Formula C2569H3928N746O781S40
Isoelectric Point 7.61
Hydrophobicity -0.516
Melting Point (℃) 60
Half Life N.A.
Description Glycosylated, human tissue plasminogen activator of 527 residues purified from CHO cells.
Indication/Disease To manage acute myocardial infarction, acute ischemic stroke and for lysis of acute pulmonary emboli
Pharmacodynamics Alteplase binds to fibrin in a thrombus and converts the entrapped plasminogen to plasmin, thus limited conversion of plasminogen takes place in the absence of fibrin.
Mechanism of Action Alteplase on binding to fibrin rich clots via the fibronectin finger-like domain and the Kringle 2 domain cleaves (domain) the Arg/Val bond in plasminogen to form plasmin which in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Thrombolytic Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication History of bleeding problems, or severe uncontrolled high blood pressure.
Side Effects Sudden arm or leg pain; sudden dizziness, fainting, severe headache, or vomiting; unusual or easy bleeding or bruising.
Useful Link N.A.
PubMed ID 15650539
3-D Structure Th1009 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

Primary information
ID	1055
ThPP ID	Th1009
Therapeutic Peptide/Protein Name	Alteplase
Sequence	SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	59042.3
Chemical Formula	C2569H3928N746O781S40
Isoelectric Point	7.61
Hydrophobicity	-0.516
Melting Point (℃)	60
Half Life	N.A.
Description	Glycosylated, human tissue plasminogen activator of 527 residues purified from CHO cells.
Indication/Disease	To manage acute myocardial infarction, acute ischemic stroke and for lysis of acute pulmonary emboli
Pharmacodynamics	Alteplase binds to fibrin in a thrombus and converts the entrapped plasminogen to plasmin, thus limited conversion of plasminogen takes place in the absence of fibrin.
Mechanism of Action	Alteplase on binding to fibrin rich clots via the fibronectin finger-like domain and the Kringle 2 domain cleaves (domain) the Arg/Val bond in plasminogen to form plasmin which in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Thrombolytic Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Ginkgo biloba.Additive anticoagulant/antiplatelet effects may increase bleeding risk. Concomitant therapy should be avoided.
Target	Plasminogen,Fibrinogen alpha chain,Urokinase plasminogen activator surface receptor,Plasminogen activator inhibitor 1
Information of corresponding available drug in the market
Brand Name	Activase
Company	Genentech Inc
Brand Discription	Activase is a tissue plasminogen activator produced by recombinant DNA technology. It is a sterile, purified glycoprotein of 527 amino acids, synthesized using the complementary DNA (cDNA) for natural human tissue-type plasminogen activator obtained from
Prescribed for	To treat blood clots in the lungs and improve heart function and survival followed by a heart attack. Activase may also be used to improve recovery and reduce disability in certain patients who have suffered from a stroke.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	Sterile, white to off-white, lyophilized powder
Route of Administration	Intravenous
Recommended Dosage	The recommended dose is not to exceed 100 mg. Patients weighing > 67 kg are recommended a dose of 100 mg as a 15 mg intravenous bolus, followed by 50 mg infused over the next 30 minutes, and then 35 mg infused over the next 60 minutes.
Contraindication	Allergic
Side Effects	Rash; hives; difficulty breathing; tightness in the chest; swelling of the mouth, face, lips, or tongue.
Useful Link	http://www.drugs.com/cdi/activase.html
PubMed ID	15650539
3-D Structure	Th1009 (View) or (Download)

Primary information
ID	1056
ThPP ID	Th1009
Therapeutic Peptide/Protein Name	Alteplase
Sequence	SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	59042.3
Chemical Formula	C2569H3928N746O781S40
Isoelectric Point	7.61
Hydrophobicity	-0.516
Melting Point (℃)	60
Half Life	N.A.
Description	Glycosylated, human tissue plasminogen activator of 527 residues purified from CHO cells.
Indication/Disease	To manage acute myocardial infarction, acute ischemic stroke and for lysis of acute pulmonary emboli
Pharmacodynamics	Alteplase binds to fibrin in a thrombus and converts the entrapped plasminogen to plasmin, thus limited conversion of plasminogen takes place in the absence of fibrin.
Mechanism of Action	Alteplase on binding to fibrin rich clots via the fibronectin finger-like domain and the Kringle 2 domain cleaves (domain) the Arg/Val bond in plasminogen to form plasmin which in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Thrombolytic Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	IV nitroglycerin may decrease the effect of alteplase.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Have active internal bleeding, history of stroke, recent brain or spinal surgery (within 3 months), a growth in the brain, abnormal formation of blood vessels.
Side Effects	Black or bloody stools; bloody vomit; change in color of your fingers or toes; changes in vision; chills; coughing up blood; decreased amount of urine produced; difficulty breathing or sudden shortness of breath; difficulty swallowing.
Useful Link	http://www.rxlist.com/activase-drug.htm
PubMed ID	15650539
3-D Structure	Th1009 (View) or (Download)

Primary information
ID	1057
ThPP ID	Th1009
Therapeutic Peptide/Protein Name	Alteplase
Sequence	SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	59042.3
Chemical Formula	C2569H3928N746O781S40
Isoelectric Point	7.61
Hydrophobicity	-0.516
Melting Point (℃)	60
Half Life	N.A.
Description	Glycosylated, human tissue plasminogen activator of 527 residues purified from CHO cells.
Indication/Disease	To manage acute myocardial infarction, acute ischemic stroke and for lysis of acute pulmonary emboli
Pharmacodynamics	Alteplase binds to fibrin in a thrombus and converts the entrapped plasminogen to plasmin, thus limited conversion of plasminogen takes place in the absence of fibrin.
Mechanism of Action	Alteplase on binding to fibrin rich clots via the fibronectin finger-like domain and the Kringle 2 domain cleaves (domain) the Arg/Val bond in plasminogen to form plasmin which in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Thrombolytic Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Ticlopidine.Increased bleeding risk. Monitor for signs of bleeding.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Certain type of bulging blood vessel (aneurysm), have a heart attack or blood clot in the lung and you also have had recent brain or spinal injury
Side Effects	Numbness in arm or leg; one-sided weakness; pain, redness, or swelling at the injection site; purple skin color; rectal bleeding; seizures; severe bleeding; severe muscle aches or pain; severe stomach pain; sharp or crushing chest pain; speech problems
Useful Link	http://www.drugs.com/drug-interactions/alteplase,activase-index.html?filter=1
PubMed ID	15650539
3-D Structure	Th1009 (View) or (Download)

Primary information
ID	1058
ThPP ID	Th1009
Therapeutic Peptide/Protein Name	Alteplase
Sequence	SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	59042.3
Chemical Formula	C2569H3928N746O781S40
Isoelectric Point	7.61
Hydrophobicity	-0.516
Melting Point (℃)	60
Half Life	N.A.
Description	Glycosylated, human tissue plasminogen activator of 527 residues purified from CHO cells.
Indication/Disease	To manage acute myocardial infarction, acute ischemic stroke and for lysis of acute pulmonary emboli
Pharmacodynamics	Alteplase binds to fibrin in a thrombus and converts the entrapped plasminogen to plasmin, thus limited conversion of plasminogen takes place in the absence of fibrin.
Mechanism of Action	Alteplase on binding to fibrin rich clots via the fibronectin finger-like domain and the Kringle 2 domain cleaves (domain) the Arg/Val bond in plasminogen to form plasmin which in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Thrombolytic Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	History of bleeding problems, or severe uncontrolled high blood pressure.
Side Effects	Sudden arm or leg pain; sudden dizziness, fainting, severe headache, or vomiting; unusual or easy bleeding or bruising.
Useful Link	N.A.
PubMed ID	15650539
3-D Structure	Th1009 (View) or (Download)

Updated version of this database is available at ThpDB2

Detailed description page of THPdb