Detailed description page of THPdb

This page displays user query in tabular form.

Th1004 details

Primary information
ID 1025
ThPP ID Th1004
Therapeutic Peptide/Protein Name Denileukin diftitox
Sequence MGADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDD view full sequnce in fasta
Functional Classification IIb
Molecular Weight 57647.3
Chemical Formula C2560H4042N678O799S17
Isoelectric Point 5.45
Hydrophobicity -0.301
Melting Point (℃) N.A.
Half Life 1.16-1.3 hours
Description A recombinant (using E. coli expression system) DNA-derived cytotoxic protein containing amino acid sequences for diphtheria toxin fragments A and B (Met 1-Thr 387)-His and sequences for interleukin-2 (Ala 1-Thr 133).
Indication/Disease Used in the treatment of cutaneous T-cell lymphoma.
Pharmacodynamics Denileukin diftitox (Ontak) uses the cytocidal action of diphtheria toxin on cells which express the IL-2 receptor. The human IL-2 receptor exists in three forms on basis of affinity, low (CD25), intermediate (CD122/CD132) and high (CD25/CD122/CD132). Malignant cells expressing one or more of the subunits of the IL-2 receptor are found in certain leukemias and lymphomas including cutaneous T-cell lymphoma (CTCL). Ontak interacts with the high affinity IL-2 receptor on the cell surface and inhibits cellular protein synthesis, resulting in cell death within hours.
Mechanism of Action Denileukin diftitox binds to the high-affinity IL-2 receptor. The IL-2 receptor (Tac) subunit is expressed on activated lymphocytes. The diphtheria toxin associated with Ontak selectively kills the IL-2 bearing cells.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution 0.06 to 0.09 L/kg
Clearance 0.6 - 2.0 mL/min/kg [Lymphoma]
Categories Antineoplastic Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Rilonacept decreases effects of toxoids by pharmacodynamic antagonism
Target Interleukin-2 receptor subunit alpha,Interleukin-2 receptor subunit beta,Cytokine receptor common subunit gamma
Information of corresponding available drug in the market
Brand Name Ontak
Company Seragen Inc
Brand Discription Ontak is a recombinant DNA-derived cytotoxic protein composed of the amino acid sequences of diphtheria toxin fragments A and B (Met1-Thr387)-His followed by sequences for human interleukin-2 (IL-2; Ala1-Thr133)
Prescribed for Treating leukemia and lymphomas, including cutaneous (of the skin) T-cell lymphoma.
Chemical Name N.A.
Formulation Ontak contains 300 mcg of recombinant denileukin diftitox in a sterile solution of citric acid (20 mM), EDTA (0.05 mM) and polysorbate 20 ( < 1%) in Water for Injection, USP. The solution has a pH range of 6.9-7.2.
Physcial Appearance Sterile, white, preservative-free, lyophilized powder.
Route of Administration Intravenous (Intravenous) administration
Recommended Dosage N.A.
Contraindication allergic
Side Effects Common side effects include:headache, dizziness, or nervousness, numbness or tingling, skin itching or rash, runny or stuffy nose; weight gain or loss; mild diarrhea or constipation, or nausea, vomiting, loss of appetite.
Useful Link http://www.drugs.com/mtm/ontak.html
PubMed ID 17454642, 17187516
3-D Structure Th1004 (View) or (Download)

Primary information
ID 1026
ThPP ID Th1004
Therapeutic Peptide/Protein Name Denileukin diftitox
Sequence MGADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDD view full sequnce in fasta
Functional Classification IIb
Molecular Weight 57647.3
Chemical Formula C2560H4042N678O799S17
Isoelectric Point 5.45
Hydrophobicity -0.301
Melting Point (℃) N.A.
Half Life 1.16-1.3 hours
Description A recombinant (using E. coli expression system) DNA-derived cytotoxic protein containing amino acid sequences for diphtheria toxin fragments A and B (Met 1-Thr 387)-His and sequences for interleukin-2 (Ala 1-Thr 133).
Indication/Disease Used in the treatment of cutaneous T-cell lymphoma.
Pharmacodynamics Denileukin diftitox (Ontak) uses the cytocidal action of diphtheria toxin on cells which express the IL-2 receptor. The human IL-2 receptor exists in three forms on basis of affinity, low (CD25), intermediate (CD122/CD132) and high (CD25/CD122/CD132). Malignant cells expressing one or more of the subunits of the IL-2 receptor are found in certain leukemias and lymphomas including cutaneous T-cell lymphoma (CTCL). Ontak interacts with the high affinity IL-2 receptor on the cell surface and inhibits cellular protein synthesis, resulting in cell death within hours.
Mechanism of Action Denileukin diftitox binds to the high-affinity IL-2 receptor. The IL-2 receptor (Tac) subunit is expressed on activated lymphocytes. The diphtheria toxin associated with Ontak selectively kills the IL-2 bearing cells.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution 0.06 to 0.09 L/kg
Clearance 0.6 - 2.0 mL/min/kg [Lymphoma]
Categories Antineoplastic Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Trastuzumab may increase the risk of neutropenia and anemia. Monitor closely for signs and symptoms of adverse events.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.rxlist.com/ontak-drug.htm
PubMed ID 17454642, 17187516
3-D Structure Th1004 (View) or (Download)

Primary information
ID 1027
ThPP ID Th1004
Therapeutic Peptide/Protein Name Denileukin diftitox
Sequence MGADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDD view full sequnce in fasta
Functional Classification IIb
Molecular Weight 57647.3
Chemical Formula C2560H4042N678O799S17
Isoelectric Point 5.45
Hydrophobicity -0.301
Melting Point (℃) N.A.
Half Life 1.16-1.3 hours
Description A recombinant (using E. coli expression system) DNA-derived cytotoxic protein containing amino acid sequences for diphtheria toxin fragments A and B (Met 1-Thr 387)-His and sequences for interleukin-2 (Ala 1-Thr 133).
Indication/Disease Used in the treatment of cutaneous T-cell lymphoma.
Pharmacodynamics Denileukin diftitox (Ontak) uses the cytocidal action of diphtheria toxin on cells which express the IL-2 receptor. The human IL-2 receptor exists in three forms on basis of affinity, low (CD25), intermediate (CD122/CD132) and high (CD25/CD122/CD132). Malignant cells expressing one or more of the subunits of the IL-2 receptor are found in certain leukemias and lymphomas including cutaneous T-cell lymphoma (CTCL). Ontak interacts with the high affinity IL-2 receptor on the cell surface and inhibits cellular protein synthesis, resulting in cell death within hours.
Mechanism of Action Denileukin diftitox binds to the high-affinity IL-2 receptor. The IL-2 receptor (Tac) subunit is expressed on activated lymphocytes. The diphtheria toxin associated with Ontak selectively kills the IL-2 bearing cells.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution 0.06 to 0.09 L/kg
Clearance 0.6 - 2.0 mL/min/kg [Lymphoma]
Categories Antineoplastic Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.drugs.com/dosage/ontak.html
PubMed ID 17454642, 17187516
3-D Structure Th1004 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

Primary information
ID	1025
ThPP ID	Th1004
Therapeutic Peptide/Protein Name	Denileukin diftitox
Sequence	MGADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDD view full sequnce in fasta
Functional Classification	IIb
Molecular Weight	57647.3
Chemical Formula	C2560H4042N678O799S17
Isoelectric Point	5.45
Hydrophobicity	-0.301
Melting Point (℃)	N.A.
Half Life	1.16-1.3 hours
Description	A recombinant (using E. coli expression system) DNA-derived cytotoxic protein containing amino acid sequences for diphtheria toxin fragments A and B (Met 1-Thr 387)-His and sequences for interleukin-2 (Ala 1-Thr 133).
Indication/Disease	Used in the treatment of cutaneous T-cell lymphoma.
Pharmacodynamics	Denileukin diftitox (Ontak) uses the cytocidal action of diphtheria toxin on cells which express the IL-2 receptor. The human IL-2 receptor exists in three forms on basis of affinity, low (CD25), intermediate (CD122/CD132) and high (CD25/CD122/CD132). Malignant cells expressing one or more of the subunits of the IL-2 receptor are found in certain leukemias and lymphomas including cutaneous T-cell lymphoma (CTCL). Ontak interacts with the high affinity IL-2 receptor on the cell surface and inhibits cellular protein synthesis, resulting in cell death within hours.
Mechanism of Action	Denileukin diftitox binds to the high-affinity IL-2 receptor. The IL-2 receptor (Tac) subunit is expressed on activated lymphocytes. The diphtheria toxin associated with Ontak selectively kills the IL-2 bearing cells.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	0.06 to 0.09 L/kg
Clearance	0.6 - 2.0 mL/min/kg [Lymphoma]
Categories	Antineoplastic Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Rilonacept decreases effects of toxoids by pharmacodynamic antagonism
Target	Interleukin-2 receptor subunit alpha,Interleukin-2 receptor subunit beta,Cytokine receptor common subunit gamma
Information of corresponding available drug in the market
Brand Name	Ontak
Company	Seragen Inc
Brand Discription	Ontak is a recombinant DNA-derived cytotoxic protein composed of the amino acid sequences of diphtheria toxin fragments A and B (Met1-Thr387)-His followed by sequences for human interleukin-2 (IL-2; Ala1-Thr133)
Prescribed for	Treating leukemia and lymphomas, including cutaneous (of the skin) T-cell lymphoma.
Chemical Name	N.A.
Formulation	Ontak contains 300 mcg of recombinant denileukin diftitox in a sterile solution of citric acid (20 mM), EDTA (0.05 mM) and polysorbate 20 ( < 1%) in Water for Injection, USP. The solution has a pH range of 6.9-7.2.
Physcial Appearance	Sterile, white, preservative-free, lyophilized powder.
Route of Administration	Intravenous (Intravenous) administration
Recommended Dosage	N.A.
Contraindication	allergic
Side Effects	Common side effects include:headache, dizziness, or nervousness, numbness or tingling, skin itching or rash, runny or stuffy nose; weight gain or loss; mild diarrhea or constipation, or nausea, vomiting, loss of appetite.
Useful Link	http://www.drugs.com/mtm/ontak.html
PubMed ID	17454642, 17187516
3-D Structure	Th1004 (View) or (Download)

Primary information
ID	1026
ThPP ID	Th1004
Therapeutic Peptide/Protein Name	Denileukin diftitox
Sequence	MGADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDD view full sequnce in fasta
Functional Classification	IIb
Molecular Weight	57647.3
Chemical Formula	C2560H4042N678O799S17
Isoelectric Point	5.45
Hydrophobicity	-0.301
Melting Point (℃)	N.A.
Half Life	1.16-1.3 hours
Description	A recombinant (using E. coli expression system) DNA-derived cytotoxic protein containing amino acid sequences for diphtheria toxin fragments A and B (Met 1-Thr 387)-His and sequences for interleukin-2 (Ala 1-Thr 133).
Indication/Disease	Used in the treatment of cutaneous T-cell lymphoma.
Pharmacodynamics	Denileukin diftitox (Ontak) uses the cytocidal action of diphtheria toxin on cells which express the IL-2 receptor. The human IL-2 receptor exists in three forms on basis of affinity, low (CD25), intermediate (CD122/CD132) and high (CD25/CD122/CD132). Malignant cells expressing one or more of the subunits of the IL-2 receptor are found in certain leukemias and lymphomas including cutaneous T-cell lymphoma (CTCL). Ontak interacts with the high affinity IL-2 receptor on the cell surface and inhibits cellular protein synthesis, resulting in cell death within hours.
Mechanism of Action	Denileukin diftitox binds to the high-affinity IL-2 receptor. The IL-2 receptor (Tac) subunit is expressed on activated lymphocytes. The diphtheria toxin associated with Ontak selectively kills the IL-2 bearing cells.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	0.06 to 0.09 L/kg
Clearance	0.6 - 2.0 mL/min/kg [Lymphoma]
Categories	Antineoplastic Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Trastuzumab may increase the risk of neutropenia and anemia. Monitor closely for signs and symptoms of adverse events.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.rxlist.com/ontak-drug.htm
PubMed ID	17454642, 17187516
3-D Structure	Th1004 (View) or (Download)

Primary information
ID	1027
ThPP ID	Th1004
Therapeutic Peptide/Protein Name	Denileukin diftitox
Sequence	MGADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDD view full sequnce in fasta
Functional Classification	IIb
Molecular Weight	57647.3
Chemical Formula	C2560H4042N678O799S17
Isoelectric Point	5.45
Hydrophobicity	-0.301
Melting Point (℃)	N.A.
Half Life	1.16-1.3 hours
Description	A recombinant (using E. coli expression system) DNA-derived cytotoxic protein containing amino acid sequences for diphtheria toxin fragments A and B (Met 1-Thr 387)-His and sequences for interleukin-2 (Ala 1-Thr 133).
Indication/Disease	Used in the treatment of cutaneous T-cell lymphoma.
Pharmacodynamics	Denileukin diftitox (Ontak) uses the cytocidal action of diphtheria toxin on cells which express the IL-2 receptor. The human IL-2 receptor exists in three forms on basis of affinity, low (CD25), intermediate (CD122/CD132) and high (CD25/CD122/CD132). Malignant cells expressing one or more of the subunits of the IL-2 receptor are found in certain leukemias and lymphomas including cutaneous T-cell lymphoma (CTCL). Ontak interacts with the high affinity IL-2 receptor on the cell surface and inhibits cellular protein synthesis, resulting in cell death within hours.
Mechanism of Action	Denileukin diftitox binds to the high-affinity IL-2 receptor. The IL-2 receptor (Tac) subunit is expressed on activated lymphocytes. The diphtheria toxin associated with Ontak selectively kills the IL-2 bearing cells.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	0.06 to 0.09 L/kg
Clearance	0.6 - 2.0 mL/min/kg [Lymphoma]
Categories	Antineoplastic Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.drugs.com/dosage/ontak.html
PubMed ID	17454642, 17187516
3-D Structure	Th1004 (View) or (Download)

Updated version of this database is available at ThpDB2

Detailed description page of THPdb