| Primary information |
|---|
| ThPP ID | Th1128 |
| Therapeutic Peptide/Protein Name | Velaglucerase alfa |
| Sequence | ARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRRME view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 63000 |
| Chemical Formula | C2532H3850N672O711S16 |
| Isoelectric Point | N.A. |
| Hydrophobicity | N.A. |
| Melting Point (℃) | N.A. |
| Half Life | 11-12 Minutes |
| Description | Gene-activated human recombinant glucocerebrosidase. It is used to treat Type 1 Gaucher disease, caused by a deficiency of the lysosomal enzyme glucocerebrosidase. Additionally, Velaglucerase alfa has also been investigated for use in Type 3 Gaucher disease. |
| Indication/Disease | Velaglucerase alfa is a hydrolytic lysosomal glucocerebroside-specific enzyme indicated for long-term enzyme replacement therapy for pediatric and adult patients with type 1 Gaucher disease. |
| Pharmacodynamics | N.A. |
| Mechanism of Action | Velaglucerase alfa catalyzes the hydrolysis of glucocerebroside, reducing the amount of accumulated glucocerebroside. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | The mean volume of distribution at steady state ranges from 82 to 108 mL/kg (8.2% to 10.8% of body weight). |
| Clearance | Mean clearance ranges from 6.72 to 7.56 mL/min/kg. |
| Categories | Enzymes |
| Patents Number | US7138262 |
| Date of Issue | 22/11/10 |
| Date of Expiry | 19/08/24 |
| Drug Interaction | N.A. |
| Target | Glucosylceramidase |
| Information of corresponding available drug in the market |
|---|
| Brand Name | VPRIV |
| Company | Shire |
| Brand Discription | The active ingredient of VPRIV is velaglucerase alfa, which is produced by gene activation technology in a human fibroblast cell line. Velaglucerase alfa is a glycoprotein of 497 amino acids; with a molecular weight of approximately 63 kDa. Velaglucerase alfa has the same amino acid sequence as the naturally occurring human enzyme, glucocerebrosidase. Velaglucerase alfa contains 5 potential N-linked glycosylation sites; four of these sites are occupied by glycan chains. Velaglucerase alfa is manufactured to contain predominantly high mannose-type N-linked glycan chains. The high mannose type N-linked glycan chains are specifically recognized and internalized via the mannose receptor present on the surface on macrophages, the cells that accumulate glucocerebroside in Gaucher disease. Velaglucerase alfa catalyzes the hydrolysis of the glycolipid glucocerebroside to glucose and ceramide in the lysosome. VPRIV is dosed by Units/kg, where one Unit of enzyme activity is defined as the quantity of enzyme required to convert one micromole of p-nitrophenyl β-D-glucopyranoside to pnitrophenol per minute at 37°C. |
| Prescribed for | long-term enzyme replacement therapy (ERT) for pediatric and adult patients with type 1 Gaucher disease. |
| Chemical Name | N.A. |
| Formulation | velaglucerase alfa (400 Units), citric acid, monohydrate (5.04 mg), polysorbate 20(0.44 mg), sodium citrate, dihydrate (51.76 mg), sucrose (200 mg) |
| Physcial Appearnce | VPRIV is supplied as a sterile, preservative free, lyophilized powder |
| Route of Administration | Intravenous infusion |
| Recommended Dosage | The recommended dose is 60 Units/kg administered every other week as a 60-minute Intravenous infusion. |
| Contraindication | N.A. |
| Side Effects | Headache, Dizziness, Abdominal pain, Nausea, Back pain, Joint pain (knee), Upper respiratory tract infection, Activated partial thromboplastin time prolonged, Infusion-related reaction*, Pyrexia, Asthenia/Fatigue |
| Useful Link | http://www.rxlist.com/vpriv-drug.htm http://www.vpriv.com/ http://www.drugs.com/vpriv.html |
| PubMed ID | 25501675, 24612151, 24581483, 24411065, 23430813, 20336596, 24630271 |
| 3-D Structure | Th1128 (View) or (Download) |