| Primary information |
|---|
| ThPP ID | Th1079 |
| Therapeutic Peptide/Protein Name | Serum albumin |
| Sequence | DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFA view full sequnce in fasta |
| Functional Classification | IV |
| Molecular Weight | 66472.2 |
| Chemical Formula | C2936H4624N786O889S41 |
| Isoelectric Point | 5.67 |
| Hydrophobicity | -0.395 |
| Melting Point (℃) | 62 |
| Half Life | N.A. |
| Description | Suspension of microspheres of human serum albumin with perflutren. Perflutren is a highly fluorinated small molecule, used to enhance contrast for ultrasound imaging procedures. |
| Indication/Disease | For treatment of severe blood loss, hypervolemia, hypoproteinemia. |
| Pharmacodynamics | Serum albumin is a soluble, monomeric protein necessary for maintaining and regulating the colloidal osmotic pressure of blood. It is used to increase the circulating plasma volume, thereby reducing hemoconcentration and blood viscosity. Also used as a transport protein that binds naturally occurring, therapeutic and toxic materials in circulation. |
| Mechanism of Action | Serum albumin acts as a high molecular weight, very soluble osmolyte. Serum albumin also acts as a protein drug carrier in plasma, and transports hemin, steroids, thyroid hormones and fatty acids. It binds many other substances, such as unconjugated bilirubin, calcium ions, and other fat soluble hormones. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Serum substitutes |
| Patents Number | US6723303 |
| Date of Issue | 21/04/05 |
| Date of Expiry | 21/04/25 |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | Albunex |
| Company | Mallinckrodt; Tyco Healthcare |
| Brand Discription | Albumin is used to replace blood volume loss resulting from trauma such as a severe burns or an injury that causes blood loss. This medicine is also used to treat low albumin levels caused by surgery, dialysis, abdominal infections, liver failure, pancreatitis, respiratory distress, bypass surgery, ovarian problems caused by fertility drugs, and other many other conditions. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | Albumin 25% may be given intravenously without dilution or it may be diluted with normal saline or 5% dextrose before administration (200 mL per liter gives a solution which is approximately isotonic and iso-osmotic with citrated plasma). |
| Physcial Appearnce | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | N.A. |
| PubMed ID | 25895349, 25755577, 12846933, 9675210, 17667792 |
| 3-D Structure | Th1079 (View) or (Download) |