Detailed description page of THPdb

This page displays user query in tabular form.

1431 details

Primary information
ThPP ID	Th1073
Therapeutic Peptide/Protein Name	Alemtuzumab
Sequence	Heavy Chain 1: QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMN view full sequnce in fasta
Functional Classification	IIa
Molecular Weight	145453.8
Chemical Formula	C6468H10066N1732O2005S40
Isoelectric Point	8.76
Hydrophobicity	-0.431
Melting Point (℃)	61 (FAB f
Half Life	288 hrs
Description	Humanized monoclonal antibody specific to lymphocyte antigens. It is a recombinant DNA-derived humanized monoclonal antibody (Campath-1H) that is directed against the 21-28 kD cell surface glycoprotein,CD52. The Campath-1H antibody is an IgG1 kappa with human variable framework and constant regions, and complementarity-determining regions from a murine (rat) monoclonal antibody (Campath-1G). Campath is produced in mammalian cell (Chinese hamster ovary) suspension culture in a medium containing neomycin.
Indication/Disease	Alemtuzumab (Campath) is a monoclonal antibody therapy used for treatment of B-cell chronic lymphocytic leukemia.
Pharmacodynamics	Campath is used to treat leukemia by exploiting antibody mediated lysis of CD52 presenting cells. The CD52 antigen is a cell surface protein found on essentially all B and T lymphocytes, a majority of monocytes, macrophages and most granulocytes. The CD52 antigen is not present on erythrocytes or hematopoetic stem cells. In leukemia there is an excess of B and T cells, so Campath permits selective reduction of lymphocyte populations.
Mechanism of Action	Campath binds to the CD52 antigen present on most B and T lymphocytes. This binding leads to antibody-dependent lysis of leukemic cells.
Toxicity	N.A.
Metabolism	Most likely removed by opsonization via the reticuloendothelial system when bound to B or T lymphocytes
Absorption	N.A.
Volume of Distribution	0.18 L/kg
Clearance	N.A.
Categories	N.A.
Patents Number	CA1339198
Date of Issue	06/08/01
Date of Expiry	06/08/18
Drug Interaction	Trastuzumab may increase the risk of neutropenia and anemia. Monitor closely for signs and symptoms of adverse events.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	CAMPATH
Company	Genzyme Corporation
Brand Discription	Campath (alemtuzumab) is a recombinant DNA-derived humanized monoclonal antibody (Campath-1H) directed against the 21-28 kD cell surface glycoprotein, CD52. Campath-1H is an IgG1 kappa antibody with human variable framework and constant regions, and complementarity-determining regions from a murine (rat) monoclonal antibody (Campath-1G). The Campath-1H antibody has an approximate molecular weight of 150 kD. Campath is produced in mammalian cell (Chinese hamster ovary)Â
Prescribed for	Campath is a CD52-directed cytolytic antibody indicated as a single agent for the treatment of B-cell chronic lymphocytic leukemia (B-CLL)
Chemical Name	N.A.
Formulation	Each single use vial of Campath contains 30 mg alemtuzumab, 8.0 mg sodium chloride, 1.44 mg dibasic sodium phosphate, 0.2 mg potassium chloride, 0.2 mg monobasic potassium phosphate, 0.1 mg polysorbate 80, and 0.0187 mg disodium edetate dihydrate. No preservatives are added.
Physcial Appearnce	Campath is a sterile, clear, colorless, isotonic solution (pH 6.8-7.4) for injection.
Route of Administration	Intravenous infusion
Recommended Dosage	Administer as an IV infusion over 2 hours, Escalate to recommended dose of 30 mg/day three times per week for 12 weeks, Premedicate with oral antihistamine and acetaminophen prior to dosing
Contraindication	None
Side Effects	Most common adverse reactions (>=10%): cytopenias, infusion reactions, cytomegalovirus (CMV) and other infections, nausea, emesis, diarrhea, and insomnia.
Useful Link	http://www.rxlist.com/campath-drug.htm
PubMed ID	27645339, 26384035, 26253589, 25887773, 25846320, 24090587, 19967103, 16810345, 16179960, 18588450, 12130484, 17051245, 9593475
3-D Structure	Th1073 (View) or (Download)