Detailed description page of THPdb

This page displays user query in tabular form.

1406 details

Primary information
ThPP ID	Th1066
Therapeutic Peptide/Protein Name	Ibritumomab
Sequence	Heavy Chain: QAYLQQSGAELVRPGASVKMSCKASGYTFTSYNMHWV view full sequnce in fasta
Functional Classification	IIb
Molecular Weight	143375.5
Chemical Formula	C6382H9830N1672O1979S54
Isoelectric Point	7.91
Hydrophobicity	-0.359
Melting Point (℃)	61 (FAB f
Half Life	0.8 hours (mammalian reticulocytes, in vitro)
Description	Indium conjugated murine IgG1 kappa monoclonal antibody directed against the CD20 antigen, which is found on the surface of normal and malignant B lymphocytes. Ibritumomab is produced in Chinese hamster ovary cells and is composed of two murine gamma 1 heavy chains of 445 amino acids each and two kappa light chains of 213 amino acids each.
Indication/Disease	For treatment of non-Hodgkin's lymphoma
Pharmacodynamics	Ibritumomab is a murine monoclonal antibody against CD20 that has been radiolabeled with yttrium-90.
Mechanism of Action	The Fab segment of the antibody targets the CD20 epitope on B-cells, allowing the radioactive yttrium to destroy the cell via production of beta particles.
Toxicity	N.A.
Metabolism	Most likely removed by opsonization via the reticuloendothelial system when bound to B cells, or by human antimurine antibody production
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	CA2149329
Date of Issue	16/07/12
Date of Expiry	13/11/17
Drug Interaction	Trastuzumab may increase the risk of neutropenia and anemia. Monitor closely for signs and symptoms of adverse events.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Zevalin
Company	Spectrum Pharmaceuticals
Brand Discription	Zevalin (ibritumomab tiuxetan) is the immunoconjugate resulting from a stable thiourea covalent bond between the monoclonal antibody ibritumomab and the linker-chelator tiuxetan [N-[2-bis(carboxymethyl)amino]-3-(p-isothiocyanatophenyl)-propyl]-[N-[2-bis(carboxymethyl)amino]-2-(methyl)-ethyl]glycine. This linker-chelator provides a high affinity, conformationally restricted chelation site for Yttrium-90. The approximate molecular weight of ibritumomab tiuxetan is 148 kD. The antibody moiety of Zevalin is ibritumomab, a murine IgGi kappa monoclonal antibody directed against the CD20 antigen.
Prescribed for	Zevalin is indicated for the treatment of relapsed or refractory, low-grade or follicular B-cell non-Hodgkin's lymphoma (NHL). Zevalin is indicated for the treatment of previously untreated follicular NHL in patients who achieve a partial or complete response to first-line chemotherapy.
Chemical Name	N.A.
Formulation	Â Each single-use vial includes 3.2 mg of ibritumomab tiuxetan in 2 mL of 0.9% Sodium Chloride.
Physcial Appearnce	Ibritumomab tiuxetan is a clear, colorless, sterile, pyrogen-free, preservative-free solution that may contain translucent particles.
Route of Administration	Intravenous infusion
Recommended Dosage	Day 1: Administer rituximab 250 mg/m2Â intravenous ; Day 7,8, or 9: Administer rituximab 250 mg/m2 Intravenous infusion If platelets â‰¥ 150,000/mm3: Within 4 hours after rituximab infusion, administer 0.4 mCi/kg (14.8 MBq per kg) Y-90 Zevalin intravenous. If platelets â‰¥ 100,000 but â‰¤ 149,000/mm3 in relapsed or refractory patients: Within 4 hours after rituximab infusion, administer 0.3 mCi/kg (11.1 MBq per kg) Y-90 Zevalin intravenous.
Contraindication	None.
Side Effects	Serious Infusion Reactions, prolonged and Severe Cytopenias, Severe Cutaneous and Mucocutaneous Reactions, Leukemia and Myelodysplastic Syndrome, Cytopenias, fatigue, nasopharyngitis, nausea, abdominal pain, asthenia, cough, diarrhea, and pyrexia.
Useful Link	http://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=ccf29429-bf8e-4cce-bd12-1de56853fc5b http://www.rxlist.com/zevalin-drug.htm
PubMed ID	16810345, 20383346, 28269762, 26758269, 22045523, 21355777, 21225019, 21225012, 20094643
3-D Structure	Th1066 (View) or (Download)