Detailed description page of THPdb

This page displays user query in tabular form.

1366 details

Primary information
ThPP ID	Th1053
Therapeutic Peptide/Protein Name	Serum albumin iodonated
Sequence	MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIA view full sequnce in fasta
Functional Classification	IV
Molecular Weight	66472.2
Chemical Formula	C2936H4624N786O889S41
Isoelectric Point	5.67
Hydrophobicity	-0.395
Melting Point (℃)	62
Half Life	N.A.
Description	A diagnostic radiopharmaceutical containing iodinated I 131 albumin for intravenous imaging. Following Intravenous infusion, radioiodinated albumin human is uniformly distributed throughout the intravascular pool within 10 minutes; extravascular distribution takes place more slowly (2 days). Indicated for use in determinations of total blood and plasma volumes, cardiac output, cardiac and pulmonary blood volumes and circulation times
Indication/Disease	For determination of total blood and plasma volumes
Pharmacodynamics	Regulates the colloidal osmotic pressure of blood. It is used to increase the circulating plasma volume, thereby reducing hemoconcentrtion and blood viscosity. Also used as a transport protein that binds naturally occurring, therapeutic and toxic materials in circulation.
Mechanism of Action	Serum albumin acts as a high molecular weight, very soluble osmolyte
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Diagnostic Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Rilonacept results in increased immunosuppressive effects; increases the risk of infection
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Jeanotope
Company	IsoTex Diagnostics
Brand Discription	Jeanotope I-125 was prepared from the blood that was non-reactive when tested for hepatitis B surface antigen (HBsAg) and HIV antibody.
Prescribed for	Jeanotope I-125 is indicated for use in the determination of total blood and plasma volume.
Chemical Name	N.A.
Formulation	Each milliliter provides approximately 10 mg protein (normal human serum albumin), 1.6 mg sodium phosphate, 16 mg sodium biphosphate, not more than 0.4 mg guanidine hydrochloride, sodium chloride for isotonicity, and 9 mg benzyl alcohol as a preservative. The stabilizer aceryltryptophanate and sodium caprylate have a concentration of less, than 0.0089M.
Physcial Appearnce	Jeanatope 1-125 (Iodinated 1-125 Albumin Injection) is a Sterile, nonpyrogenic, aqueos solution
Route of Administration	Intravenous infusion
Recommended Dosage	When a procedure such as a blood volume determination is to be repeated, the total dosage administered in any one week should not exceed 7.4 megabecquerels, (200 microcuries).
Contraindication	At present there are no known contraindications to the use of this preparation
Side Effects	ï»¿Although the immunological properties of albumin human are believed to be virtuallyÂ unaltered by the iodination process, there is a theoretical possibility that allergic reactions may occur in patients receiving additional doses a number of weeks after an initial dose.
Useful Link	http://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=7b6f6a5e-f456-4db9-a3da-44d870ee6547
PubMed ID	17139284, 17016424
3-D Structure	Th1053 (View) or (Download)