A database of FDA approved therapeutic peptides and proteins
| This page displays user query in tabular form. |
1365 details |
| Primary information | |
|---|---|
| ThPP ID | Th1053 |
| Therapeutic Peptide/Protein Name | Serum albumin iodonated |
| Sequence | MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIA view full sequnce in fasta |
| Functional Classification | IV |
| Molecular Weight | 66472.2 |
| Chemical Formula | C2936H4624N786O889S41 |
| Isoelectric Point | 5.67 |
| Hydrophobicity | -0.395 |
| Melting Point (℃) | 62 |
| Half Life | N.A. |
| Description | A diagnostic radiopharmaceutical containing iodinated I 131 albumin for intravenous imaging. Following Intravenous infusion, radioiodinated albumin human is uniformly distributed throughout the intravascular pool within 10 minutes; extravascular distribution takes place more slowly (2 days). Indicated for use in determinations of total blood and plasma volumes, cardiac output, cardiac and pulmonary blood volumes and circulation times |
| Indication/Disease | For determination of total blood and plasma volumes |
| Pharmacodynamics | Regulates the colloidal osmotic pressure of blood. It is used to increase the circulating plasma volume, thereby reducing hemoconcentrtion and blood viscosity. Also used as a transport protein that binds naturally occurring, therapeutic and toxic materials in circulation. |
| Mechanism of Action | Serum albumin acts as a high molecular weight, very soluble osmolyte. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Diagnostic Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | Apolipoprotein E,Serum amyloid A-1 protein,Protein AMBP |
| Information of corresponding available drug in the market | |
| Brand Name | Megatope |
| Company | IsoTex Diagnostics |
| Brand Discription | Megatope (Iodinated I 131 Albumin Injection) is a diagonostic radiopharmaceutical containing iodinated I 131 albumin. Megatope was prepared from blood that was nonreactive when tested for hepatitis |
| Prescribed for | Megatope (Iodinated I 131 Albumin Injection) is indicated for use in determinations of total blood and plasma volumes, cardiac output, cardiac and pulmonary blood volumes and circulation times, and in protein turnover studies, heart and great vessel,dilineation, localization of the placenta, and localization of celebral neospasms |
| Chemical Name | N.A. |
| Formulation | Each mL of sterile, nonpyrogenic, aqueous, colorless to very pale yellow solution provides approximate 10 mg, protein (albumin human), 16 mg dibasic sodium phosphate, 1.6 mg monobasic, sodium phosphate, not more than 0.4 guanidine hydrochloride, sodium chloride, for isotonicity, and 9 mg benzyl alcohol as a preservative. |
| Physcial Appearnce | Megatope (Iodinated I 131 Albumin Injection) may be colorless to very pale yellow solution |
| Route of Administration | Injection for Intravenous administration |
| Recommended Dosage | The total dosage administered in any one week should not exceed 200 microcuries |
| Contraindication | None Known. |
| Side Effects | Although the immunological properties of albumin human are believed to be virtually unaltered by the iodination process, there is a theoretical possibility that allergic reactions may occur in patients receiving additional doses a number of weeks after an initial dose. |
| Useful Link | http://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=62ca4278-8cc9-46b7-8f3c-303ce6a9c155 |
| PubMed ID | 17139284, 17016423 |
| 3-D Structure | Th1053 (View) or (Download) |