| Primary information |
|---|
| ThPP ID | Th1051 |
| Therapeutic Peptide/Protein Name | Human Serum Albumin |
| Sequence | MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIA view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 66472.2 |
| Chemical Formula | C2936H4624N786O889S41 |
| Isoelectric Point | 5.67 |
| Hydrophobicity | -0.395 |
| Melting Point (℃) | 62 |
| Half Life | N.A. |
| Description | Human serum albumin isolated from expired blood plasma. |
| Indication/Disease | Human Serum Albumin is indicated for treatment of severe blood loss, hypervolemia, hypoproteinemia. |
| Pharmacodynamics | Human Serum Albumin regulates the colloidal osmotic pressure of blood. It is used to increase the circulating plasma volume, thereby reducing hemoconcentrtion and blood viscosity. Also used as a transport protein that binds naturally occurring, therapeutic and toxic materials in circulation. |
| Mechanism of Action | Human Serum albumin acts as a high molecular weight, very soluble osmolyte. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Serum substitutes |
| Patents Number | US5558094 |
| Date of Issue | 01/03/99 |
| Date of Expiry | 29/02/16 |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | Albutein |
| Company | GRIFOLS |
| Brand Discription | Albutein is a concentrate of plasma proteins from human blood. It works by increasing plasma volume or serum albumin levels. |
| Prescribed for | For treatment of hypovolemic shock,As an adjunct in hemodialysis for patients undergoing long-term dialysis or for those patients who are fluid-overloaded and cannot tolerate substantial volumes of salt solution for therapy of shock or hypotension |
| Chemical Name | N.A. |
| Formulation | Albutein 20% is clinically desirable, compatible diluents include sterile 0.9% Sodium Chloride solution or sterile 5% Dextrose in Water. |
| Physcial Appearnce | Albutein 20% is a Sterile, aqueous solution for single dose intravenous administration containing 20% human albumin (weight/volume). |
| Route of Administration | Albutein 20% is to be administered by the Intraven |
| Recommended Dosage | Albutein 20% is administered intravenously. The total dosage will vary with the individual. In adults, an initial infusion of 100 mL is suggested. |
| Contraindication | Albutein 20% is contraindicated in patients with severe anemia or cardiac failure in the presence of normal or increased intravascular volume. |
| Side Effects | The most common adverse reactions include fever and chills, rash, nausea, vomiting, tachycardia and hypotension. Should an adverse reaction occur, slow or stop the infusion for a short period of time which may result in the disappearance of the symptoms. If administration has been stopped and the patient requires additional Albutein 20%, material from a different lot should be used. |
| Useful Link | Peters, T., Jr., Serum Albumin in:Â The Plasma Proteins, 2nd Ed., Putnam F.W. (ed), New York, Academic Press, 1:133-181, 1975. Finlayson, J.S., Albumin Products Semin Thromb Hemo, 6:85-120, 1980. |
| PubMed ID | 12846933, 9675210 |
| 3-D Structure | Th1051 (View) or (Download) |