| Primary information |
|---|
| ThPP ID | Th1044 |
| Therapeutic Peptide/Protein Name | Adalimumab |
| Sequence | Light-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 144190.3 |
| Chemical Formula | C6428H9912N1694O1987S46 |
| Isoelectric Point | 8.25 |
| Hydrophobicity | -0.441 |
| Melting Point (℃) | N.A. |
| Half Life | 240-480 hours |
| Description | Adalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system. |
| Indication/Disease | For treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease. |
| Pharmacodynamics | Used in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction. |
| Mechanism of Action | Adalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement. |
| Toxicity | N.A. |
| Metabolism | Most likely removed by opsonization via the reticuloendothelial system. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 13 mL/hr [RA patients with dose 0.25-10 mg/kg] |
| Categories | Anti-Inflammatory Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | Trastuzumab may increase the risk of neutropenia and anemia. Monitor closely for signs and symptoms of adverse events. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearnce | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | Patent Information Link:http://www.freepatentsonline.com/6090382.html |
| PubMed ID | 25629655, 23620660 |
| 3-D Structure | Th1044 (View) or (Download) |