Detailed description page of THPdb

This page displays user query in tabular form.

1316 details

Primary information
ThPP ID	Th1044
Therapeutic Peptide/Protein Name	Adalimumab
Sequence	Light-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	144190.3
Chemical Formula	C6428H9912N1694O1987S46
Isoelectric Point	8.25
Hydrophobicity	-0.441
Melting Point (℃)	N.A.
Half Life	240-480 hours
Description	Adalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system.
Indication/Disease	For treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease.
Pharmacodynamics	Used in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction.
Mechanism of Action	Adalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement.
Toxicity	N.A.
Metabolism	Most likely removed by opsonization via the reticuloendothelial system.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	12 mL/hr [RA patients with dose 0.25-10 mg/kg]
Categories	Antirheumatic Agents
Patents Number	CA2243459
Date of Issue	17/09/02
Date of Expiry	10/02/17
Drug Interaction	Canakinumab and Rilonacept increase immunosuppressive effects and risk of infection.
Target	Tumor necrosis factor,Low affinity immunoglobulin gamma Fc region receptor III-B,Complement C1r subcomponent,Complement C1q subcomponent subunit A,Complement C1q subcomponent subunit B,Complement C1q subcomponent subunit C,Low affinity immunoglobulin gamm
Information of corresponding available drug in the market
Brand Name	Humira
Company	Abbott Laboratories
Brand Discription	HUMIRA is a recombinant human IgG1 monoclonal antibody specific for human tumor necrosis factor. HUMIRA was created using phage display technology resulting in an antibody with human derived heavy and light chain variable regions and human IgG1:k constant
Prescribed for	Humira is used to treat rheumatoid arthritis, juvenile idiopathic arthritis, psoriatic arthritis, ankylosing spondylitis, and plaque psoriasis. It is also used to treat Crohn's disease or ulcerative colitis, after other drugs have been tried without succe
Chemical Name	N.A.
Formulation	It is supplied for a single use. Each prefilled syringe delivers 0.8 mL (40 mg) of drug product. Each 0.8 mL of HUMIRA contains 40 mg adalimumab, 4.93 mg sodium chloride, 0.69 mg monobasic sodium phosphate dihydrate, 1.22 mg dibasic sodium phosphate dihyd
Physcial Appearnce	Sterile, preservative-free solution
Route of Administration	Subcutaneous administration
Recommended Dosage	The recommended dose of HUMIRA for adult patients with rheumatoid arthritis (RA), psoriatic arthritis (PsA), or ankylosing spondylitis (AS) is 40 mg administered every other week. Methotrexate (MTX), other non-biologic DMARDS, glucocorticoids, nonsteroidal anti-inflammatory drugs (NSAIDs), and/or analgesics may be continued during treatment with HUMIRA.
Contraindication	Hypersensitivity
Side Effects	Fever, chills, sore throat, vomiting, diarrhea, flu symptoms, pain or burning when you urinate; signs of tuberculosis - fever with ongoing cough, weight loss (fat or muscle); pale skin, easy bruising or bleeding (nosebleeds, bleeding gums); numbness.
Useful Link	PDB sequence Link:http://www.rcsb.org/pdb/download/downloadFile.do?fileFormat=FASTA;compression=NO;structureId=1IGT
PubMed ID	25629655, 23620660
3-D Structure	Th1044 (View) or (Download)