Detailed description page of THPdb

This page displays user query in tabular form.

1305 details

Primary information
ThPP ID	Th1043
Therapeutic Peptide/Protein Name	Rasburicase
Sequence	SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	34109.5
Chemical Formula	C1521H2381N417O461S7
Isoelectric Point	7.16
Hydrophobicity	-0.465
Melting Point (℃)	N.A.
Half Life	18 hours
Description	Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus.
Indication/Disease	For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy).
Pharmacodynamics	Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis.
Mechanism of Action	Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin).
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	110 to 127 mL/kg [pediatric patients]
Clearance	N.A.
Categories	Gout Suppressants
Patents Number	CA2175971
Date of Issue	30/12/03
Date of Expiry	07/05/16
Drug Interaction	amyl nitrite / sodium nitrite / sodium thiosulfate
Target	Uric acid
Information of corresponding available drug in the market
Brand Name	Elitek
Company	Sanofi-Synthelabo Inc
Brand Discription	Elitek is a recombinant urate-oxidase produced by a genetically modified Saccharomyces cerevisiae strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus. Rasburicase is a tetrameric protein with identical subunits. Each sub
Prescribed for	Used for preventing high blood levels of uric acid from occurring in patients with certain types of cancer (eg, leukemia, lymphoma, solid malignant tumors) who are receiving cancer chemotherapy treatment.
Chemical Name	N.A.
Formulation	Elitek is supplied in 3 mL and 10 mL colorless, glass vials containing rasburicase at a concentration of 1.5 mg/mL after reconstitution. Elitek 1.5 mg presentation contains 1.5 mg rasburicase, 10.6 mg mannitol, 15.9 mg L-alanine, between 12.6 and 14.3 mg
Physcial Appearnce	Sterile, white to off-white, lyophilized powder
Route of Administration	Intravenous administration
Recommended Dosage	The recommended dose of Elitek is 0.2 mg/kg as a 30 minute Intravenous infusion daily for up to 5 days. Dosing beyond 5 days or administration of more than one course is not recommended.
Contraindication	Pateints with history of anaphylaxic or severe hypersensitivity
Side Effects	Rash; hives; itching; difficulty breathing; tightness in the chest; swelling of the mouth, face, lips, or tongue; blue or gray skin color; chest pain; chills; coughing up blood; dark urine; fever; irregular heartbeat; numbness or tingling of the skin; persistent sore throat; severe dizziness; shortness of breath, trouble breathing, or wheezing; swelling of the hands or feet; weakness; yellowing of the eyes and skin.
Useful Link	http://www.elitek.us
PubMed ID	20445229, 20394650
3-D Structure	Th1043 (View) or (Download)