Primary information |
---|
ThPP ID | Th1043 |
Therapeutic Peptide/Protein Name | Rasburicase |
Sequence | SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta |
Functional Classification | Ic |
Molecular Weight | 34109.5 |
Chemical Formula | C1521H2381N417O461S7 |
Isoelectric Point | 7.16 |
Hydrophobicity | -0.465 |
Melting Point (℃) | N.A. |
Half Life | 18 hours |
Description | Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus. |
Indication/Disease | For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy). |
Pharmacodynamics | Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis. |
Mechanism of Action | Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin). |
Toxicity | N.A. |
Metabolism | N.A. |
Absorption | N.A. |
Volume of Distribution | 110 to 127 mL/kg [pediatric patients] |
Clearance | N.A. |
Categories | Gout Suppressants |
Patents Number | CA2175971 |
Date of Issue | 30/12/03 |
Date of Expiry | 07/05/16 |
Drug Interaction | amyl nitrite / sodium nitrite / sodium thiosulfate |
Target | Uric acid |
Information of corresponding available drug in the market |
---|
Brand Name | Elitek |
Company | Sanofi-Synthelabo Inc |
Brand Discription | Elitek is a recombinant urate-oxidase produced by a genetically modified Saccharomyces cerevisiae strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus. Rasburicase is a tetrameric protein with identical subunits. Each sub |
Prescribed for | Used for preventing high blood levels of uric acid from occurring in patients with certain types of cancer (eg, leukemia, lymphoma, solid malignant tumors) who are receiving cancer chemotherapy treatment. |
Chemical Name | N.A. |
Formulation | Elitek is supplied in 3 mL and 10 mL colorless, glass vials containing rasburicase at a concentration of 1.5 mg/mL after reconstitution. Elitek 1.5 mg presentation contains 1.5 mg rasburicase, 10.6 mg mannitol, 15.9 mg L-alanine, between 12.6 and 14.3 mg |
Physcial Appearnce | Sterile, white to off-white, lyophilized powder |
Route of Administration | Intravenous administration |
Recommended Dosage | The recommended dose of Elitek is 0.2 mg/kg as a 30 minute Intravenous infusion daily for up to 5 days. Dosing beyond 5 days or administration of more than one course is not recommended. |
Contraindication | Pateints with history of anaphylaxic or severe hypersensitivity |
Side Effects | Rash; hives; itching; difficulty breathing; tightness in the chest; swelling of the mouth, face, lips, or tongue; blue or gray skin color; chest pain; chills; coughing up blood; dark urine; fever; irregular heartbeat; numbness or tingling of the skin; persistent sore throat; severe dizziness; shortness of breath, trouble breathing, or wheezing; swelling of the hands or feet; weakness; yellowing of the eyes and skin. |
Useful Link | http://www.elitek.us |
PubMed ID | 20445229, 20394650 |
3-D Structure | Th1043 (View) or (Download) |