Updated version of this database is available at ThpDB2

Detailed description page of THPdb

This page displays user query in tabular form.

1269 details
Primary information
ThPP IDTh1039
Therapeutic Peptide/Protein NameLutropin alfa
SequenceAlpha Chain: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAY view full sequnce in fasta
Functional ClassificationIb
Molecular Weight30000
Chemical FormulaC1014H1609N287O294S27
Isoelectric Point8.44
Hydrophobicity-0.063
Melting Point (℃)55
Half Life4.4 hours (mammalian reticulocytes, in vitro)
DescriptionLutropin alfa is a recombinant human luteinizing hormone produced in yeast with 2 subunits, alpha = 92 residues, beta = 121 residues. It is a heterodimeric glycoprotein. Each monomeric unit is a glycoprotein molecule. In females, an acute rise of LH(LH surge) triggers ovulation and the development of the corpus luteum. In males, it stimulates Leydig cell production of testosterone. Lutropin alfa was the first and only recombinant human form of luteinizing hormone (LH) developed for use in the stimulation of follicular development.
Indication/DiseaseFor treatment of female infertility
PharmacodynamicsUsed to facilitate female conception, lutropin alfa performs the same actions as luteinizing hormone, which is normally produced in the pituitary gland. Lutropin is usually given in combination with follitropin alfa. In females, a LH surge about halfway through the menstrual cycle triggers the onset of ovulation. LH also induces the ovulated follicle to become a corpus luteum, which then secretes progesterone.
Mechanism of ActionBinds to the luteinizing hormone receptor which then activates adenylate cylcase through G protein mediation. Adenylate cyclase then activates many other pathways leading to steroid hormone production and other follicle maturation processes.
ToxicityN.A.
MetabolismN.A.
AbsorptionN.A.
Volume of Distribution10 L
Clearance2-3 L/h [healthy female following subcutaneous administration]. Total body clearance is approximately 2 to 3 L/h with less than 5 percent of the dose being excreted unchanged renally.
CategoriesFertility Agents
Patents NumberUS5767251
Date of Issue16/06/95
Date of Expiry16/06/15
Drug InteractionOther drugs may interact with lutropin alfa, including prescription and over-the-counter medicines, vitamins, and herbal products
TargetLutropin-choriogonadotropic hormone receptor
Information of corresponding available drug in the market
Brand NameLuveris
CompanySerono
Brand DiscriptionLuveris is a purified form of a hormone called luteinizing hormone, or LH. This hormone is important in the development of follicles (eggs) produced by the ovaries in women.
Prescribed forLuveris is used together with follitropin alfa to treat infertility in women with LH deficiency.
Chemical NameN.A.
FormulationOne vial contains 75 IU of lutropin alfa (recombinant human Luteinising Hormone {r-hLH}) and following excipeint is present; Powder:Sucrose,Disodium phosphate dihydrate,Sodium dihydrogen phosphate monohydrate,Polysorbate 20,Phosphoric acid, concentrated (
Physcial AppearnceWhite lyophilised pellet withg clear colourless solvent to make solution
Route of AdministrationSubcutaneous (Subcutaneous) administration
Recommended DosageIt is recommended that 75 IU Luveris be concomitantly administered subcutaneously with 75 IU to 150 IU Gonal-f as two separate injections in the initial treatment cycle
ContraindicationHypersensitivity
Side EffectsNausea, stomach pain, diarrhea, constipation, gas; pelvic pain, menstrual cramps; breast pain; headache; pain or irritation where the injection was given; tired feeling; or cold symptoms such as stuffy nose, sneezing, sore throat.
Useful Linkhttp://www.drugs.com/luveris.html
PubMed ID20238314, 18627209
3-D StructureTh1039 (View) or (Download)