| Primary information |
|---|
| ThPP ID | Th1037 |
| Therapeutic Peptide/Protein Name | Botulinum Toxin Type B |
| Sequence | MPVTINNFNYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERY view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 150804 |
| Chemical Formula | C690H1115N177O202S6 |
| Isoelectric Point | N.A. |
| Hydrophobicity | N.A. |
| Melting Point (℃) | N.A. |
| Half Life | N.A. |
| Description | Neurotoxin produced by fermentation of clostridium botulinum type B. The protein exists in noncovalent association with hemagglutinin and nonhemagglutinin proteins as a neurotoxin complex. The neurotoxin complex is recovered from the fermentation process. |
| Indication/Disease | To treat patients with cervical dystonia to reduce the severity of abnormal head position and neck pain associated with cervical dystonia. |
| Pharmacodynamics | Botulinum Toxin Type B inhibits acetylcholine release at the neuromuscular junction via a three stage process: 1) Heavy Chain mediated neurospecific binding of the toxin, 2) internalization of the toxin by receptor-mediated endocytosis, and 3) ATP and pH dependent translocation of the Light Chain to the neuronal cytosol where it acts as a zinc-dependent endoprotease cleaving polypeptides essential for neurotransmitter release. |
| Mechanism of Action | Botulinum Toxin Type B binds and cleaves the synaptic Vesicle Associated Membrane Protein (VAMP, also known as synaptobrevin) which is a component of the protein complex responsible for docking and fusion of the synaptic vesicle to the presynaptic membrane, a necessary step to neurotransmitter release. |
| Toxicity | One unit of Botulinum Toxin Type B corresponds to the calculated median lethal intraperitoneal dose (LD50) in mice. |
| Metabolism | N.A. |
| Absorption | Botulinum Toxin Type B is not expected to be present in the peripheral blood at measurable levels following IM injection at the recommended doses as pharmacokinetic or ADME studies were not performed |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Antidystonic Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearnce | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | Rash; hives; itching; difficulty breathing; tightness in the chest; swelling of the mouth, face, lips, or tongue; bleeding at the injection site; chest pain; difficulty swallowing or breathing; double or blurred vision, or other vision changes; drooping eyelids, hoarseness, change in or loss of voice; loss of bladder control; or trouble speaking, breathing, or swallowing. |
| Useful Link | http://www.drugs.com/drug-interactions/botulinum-toxin-type-b,myobloc-index.html |
| PubMed ID | 10534247, 10534247 |
| 3-D Structure | Th1037 (View) or (Download) |