| Primary information |
|---|
| ThPP ID | Th1021 |
| Therapeutic Peptide/Protein Name | Thyrotropin Alfa |
| Sequence | Alpha chain:APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYP view full sequnce in fasta |
| Functional Classification | IV |
| Molecular Weight | 22672.9 |
| Chemical Formula | C975H1513N267O304S26 |
| Isoelectric Point | 7.5 |
| Hydrophobicity | -0.33 |
| Melting Point (℃) | 55 |
| Half Life | 5 ± 10 hours |
| Description | Thyrotropin alfa is a recombinant form of thyroid stimulating hormone used in performing certain tests in patients who have or have had thyroid cancer. It is also used along with a radioactive agent to destroy remaining thyroid tissue in certain patients. |
| Indication/Disease | For detection of residueal or recurrent thyroid cancer |
| Pharmacodynamics | Binding of thyrotropin alfa to TSH receptors on normal thyroid epithelial cells or on well-differentiated thyroid cancer tissue stimulates iodine uptake and organification. Thyrogen is an exogenous source of human TSH that offers an additional diagnostic tool in the follow-up of patients with a history of well-differentiated thyroid cancer. |
| Mechanism of Action | Binding of thyrotropin Alfa to the thyrotropin receptors found on any residual thyroid cells or tissues stimulates radioactive iodine uptake for better radiodiagnostic imaging. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | Through kidney and liver |
| Categories | Diagnostic Agents |
| Patents Number | US5840566 |
| Date of Issue | 24/11/95 |
| Date of Expiry | 24/11/15 |
| Drug Interaction | N.A. |
| Target | Thyrotropin receptor |
| Information of corresponding available drug in the market |
|---|
| Brand Name | Thyrogen |
| Company | Genzyme Inc |
| Brand Discription | THYROGEN contains recombinant human thyroid stimulating hormone (TSH). Thyrotropin alfa is synthesized in a genetically modified Chinese hamster ovary cell line. Thyrotropin alfa is a heterodimeric glycoprotein comprised of two non-covalently linked subun |
| Prescribed for | It is used in performing certain tests in patients who have or have had thyroid cancer. It is also used along with a radioactive agent to destroy remaining thyroid tissue in certain patients who have had their thyroid gland removed because of thyroid canc |
| Chemical Name | N.A. |
| Formulation | Each vial of THYROGEN contains 1.1 mg thyrotropin alfa, 36 mg Mannitol, 5.1 mg Sodium Phosphate, and 2.4 mg Sodium Chloride. |
| Physcial Appearnce | Lyophilized powder |
| Route of Administration | IntramuSubcutaneousular preferably the buttocks |
| Recommended Dosage | A 0.9 mg intramuscular injection to the buttock followed by a second 0.9 mg intramuscular injection to the buttock 24 hours later. |
| Contraindication | Allergic |
| Side Effects | Rash; hives; itching; difficulty breathing; tightness in the chest |
| Useful Link | http://www.rxlist.com/thyrogen-drug.htm |
| PubMed ID | 23389953, 26622936, 24040896, 23406027, 23389953, 23014071, 22551128, 21607603, 21404570 |
| 3-D Structure | Th1021 (View) or (Download) |