| Primary information |
|---|
| ThPP ID | Th1017 |
| Therapeutic Peptide/Protein Name | Sargramostim |
| Sequence | APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQ view full sequnce in fasta |
| Functional Classification | Ib |
| Molecular Weight | 14434.5 |
| Chemical Formula | C639H1006N168O196S8 |
| Isoelectric Point | 5.05 |
| Hydrophobicity | N.A. |
| Melting Point (℃) | N.A. |
| Half Life | N.A. |
| Description | Sargramostim (127 residue glycoprotein) is a human recombinant granulocyte macrophage colony-stimulating factor expressed in yeast system. Substitution of Leu23 leads to a difference from native protein. |
| Indication/Disease | Used to treat cancer and in bone marrow transplant |
| Pharmacodynamics | Sargramostim is used in the treatment of bone marrow transplant recipients or those exposed to chemotherapy and recovering from acute myelogenous leukemia, Leukine or GM-CSF is a hematopoietic growth factor which stimulates the survival, clonal expansion (proliferation) and differentiation of hematopoietic progenitor cells. GM-CSF is also capable of activating mature granulocytes and macrophages. After a bone marrow transplant or chemotherapy, patients have a reduced capacity to produce red and white blood cells. Supplementing them with external sources of GM-CSF helps bring the level of neutrophils back to normal so that they can better fight infections. |
| Mechanism of Action | Sargramostim binds to the Granulocyte-macrophage colony stimulating factor receptor which stimulates a JAK2 STAT1/STAT3 signal transduction pathway which leads to the production of hemopoietic cells and neutrophils |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 431 mL/min/m2 [Normal people with lyophilized LEUKINE (IV)] |
| Categories | Immunosuppressive Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearnce | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | Occasionally irritation at the injection site. |
| Useful Link | http://www.igenericdrugs.com/?s=leucomax%20%28novartis%29 |
| PubMed ID | 25416452, 25270293, 15583528, 25270293, 27838641, 27783330, 27576783, 27619199, 27141384 |
| 3-D Structure | Th1017 (View) or (Download) |