| Primary information |
|---|
| ThPP ID | Th1014 |
| Therapeutic Peptide/Protein Name | Salmon Calcitonin |
| Sequence | CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP view full sequnce in fasta |
| Functional Classification | Ib |
| Molecular Weight | 3431.853 |
| Chemical Formula | C145H240N44O48S2 |
| Isoelectric Point | 8.86 |
| Hydrophobicity | -0.537 |
| Melting Point (℃) | N.A. |
| Half Life | 0.83-1.33 hours |
| Description | Synthetic peptide of 32 residues, formulated as a nasal spray. |
| Indication/Disease | Used for the treatment of post-menopausal osteoporosis. |
| Pharmacodynamics | Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney. |
| Mechanism of Action | Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway. |
| Toxicity | It is devoid of embryotoxic, teratogenic and mutagenic potential. |
| Metabolism | Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule. |
| Absorption | Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively). |
| Volume of Distribution | N.A. |
| Clearance | Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney. |
| Categories | Anti-Osteporotic Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | Foscavir (foscarnet) |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | To reduce high levels of calcium in the blood (hypercalcemia) |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearnce | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | Swelling or irritation of the skin where an injection was given. |
| Useful Link | http://www.rxmed.com/b.main/b2.pharmaceutical/b2.1.monographs/CPS-%20Monographs/CPS-%20%28General%20Monographs-%20C%29/CALCIMAR.html |
| PubMed ID | 25860966, 24708057, 24357414, 24252061, 22001608, 20946924, 18704953, 18023905, 17207880 |
| 3-D Structure | Th1014 (View) or (Download) |