| Primary information |
|---|
| ThPP ID | Th1014 |
| Therapeutic Peptide/Protein Name | Salmon Calcitonin |
| Sequence | CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP view full sequnce in fasta |
| Functional Classification | Ib |
| Molecular Weight | 3431.853 |
| Chemical Formula | C145H240N44O48S2 |
| Isoelectric Point | 8.86 |
| Hydrophobicity | -0.537 |
| Melting Point (℃) | N.A. |
| Half Life | 0.83-1.33 hours |
| Description | Synthetic peptide of 32 residues, formulated as a nasal spray. |
| Indication/Disease | Used for the treatment of post-menopausal osteoporosis. |
| Pharmacodynamics | Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney. |
| Mechanism of Action | Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway. |
| Toxicity | It is devoid of embryotoxic, teratogenic and mutagenic potential. |
| Metabolism | Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule. |
| Absorption | Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively). |
| Volume of Distribution | N.A. |
| Clearance | Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney. |
| Categories | Bone Density Conservation Agents |
| Patents Number | US6440392 |
| Date of Issue | 02/02/01 |
| Date of Expiry | 02/02/21 |
| Drug Interaction | Eskalith (lithium) |
| Target | Calcitonin receptor |
| Information of corresponding available drug in the market |
|---|
| Brand Name | Calcimar |
| Company | N.A. |
| Brand Discription | Calcitonin is a group of polypeptide hormones secreted by the thyroid gland in mammals and by the ultimobranchial gland of birds and fish. It is of physiological importance in the regulation of calcium metabolism in certain animal species, and may also ha |
| Prescribed for | To treat Paget's disease of bone |
| Chemical Name | N.A. |
| Formulation | Each mL of sterile solution contains calcitonin salmon 200 IU. Nonmedicinal ingredients include acetic acid, phenol, sodium acetate, sodium chloride, sodium hydroxide and water for injection. |
| Physcial Appearnce | Solution |
| Route of Administration | Subcutaneous or intramuSubcutaneousular Injection |
| Recommended Dosage | Based on body weight and injected every 12 hours |
| Contraindication | Allergy |
| Side Effects | Feeling light-headed, fainting; or muscle stiffness. |
| Useful Link | http://www.drugs.com/sfx/calcimar-side-effects.html |
| PubMed ID | 25860966, 24708057, 24357414, 24252061, 22001608, 20946924, 18704953, 18023905, 17207880 |
| 3-D Structure | Th1014 (View) or (Download) |