A database of FDA approved therapeutic peptides and proteins
This page displays user query in tabular form. |
1076 details |
Primary information | |
---|---|
ThPP ID | Th1013 |
Therapeutic Peptide/Protein Name | Epoetin alfa |
Sequence | APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta |
Functional Classification | Ib |
Molecular Weight | 18396.1 |
Chemical Formula | C815H1317N233O241S5 |
Isoelectric Point | 8.75 |
Hydrophobicity | N.A. |
Melting Point (℃) | 53 |
Half Life | N.A. |
Description | It is recombinant human erythropoietin which is produced by CHO cells. |
Indication/Disease | For treatment of anemia (from renal transplants or certain HIV treatment). |
Pharmacodynamics | Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass. |
Mechanism of Action | Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation. |
Toxicity | N.A. |
Metabolism | N.A. |
Absorption | N.A. |
Volume of Distribution | N.A. |
Clearance | N.A. |
Categories | N.A. |
Patents Number | N.A. |
Date of Issue | N.A. |
Date of Expiry | N.A. |
Drug Interaction | N.A. |
Target | N.A. |
Information of corresponding available drug in the market | |
Brand Name | Epogen |
Company | Amgen Inc. |
Brand Discription | Epogen(165-amino acid, 30,400 daltons) is an erythropoiesis-stimulating glycoprotein manufactured by recombinant DNA technology. It is produced by mammalian cells into which the human erythropoietin gene has been introduced. The product contains the ident |
Prescribed for | Epogen is used to treat anemia in patients with chronic kidney disease. Epogen is also used in HIV patients who have anemia due to treatment with zidovudine and in cancer patients who have anemia due to chemotherapy. |
Chemical Name | N.A. |
Formulation | Each 1 mL vial contains 2000, 3000, 4000, or 10,000 Units of epoetin alfa, Albumin (Human) (2.5 mg), citric acid (0.06 mg), sodium chloride (5.9 mg), and sodium citrate (5.8 mg) in Water for Injection, USP (pH 6.9 ± 0.3). Single-dose 1 mL vials formulated |
Physcial Appearnce | Sterile, colorless liquid |
Route of Administration | Subcutaneous Injection |
Recommended Dosage | N.A. |
Contraindication | Allergic, untreated or uncontrolled high blood pressure; or if you have ever had pure red cell aplasia (PRCA, a type of anemia) caused by using darbepoetin alfa or epoetin alfa. |
Side Effects | Feeling light-headed, fainting; fever, chills, body aches, flu symptoms, sores in your mouth and throat; pale skin, feeling short of breath, rapid heart rate, trouble concentrating; easy bruising, unusual bleeding (nose, mouth, vagina, or rectum), purple |
Useful Link | http://www.drugs.com/epogen.html |
PubMed ID | 20369312, 18208642 |
3-D Structure | Th1013 (View) or (Download) |