| Primary information |
|---|
| ThPP ID | Th1013 |
| Therapeutic Peptide/Protein Name | Epoetin alfa |
| Sequence | APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta |
| Functional Classification | Ib |
| Molecular Weight | 18396.1 |
| Chemical Formula | C815H1317N233O241S5 |
| Isoelectric Point | 8.75 |
| Hydrophobicity | N.A. |
| Melting Point (℃) | 53 |
| Half Life | N.A. |
| Description | It is recombinant human erythropoietin which is produced by CHO cells. |
| Indication/Disease | For treatment of anemia (from renal transplants or certain HIV treatment). |
| Pharmacodynamics | Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass. |
| Mechanism of Action | Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 23.6 ± 9.5 mL/h/kg [150 Units/kg SC TIW, Week 3 when anemic cancer patients were not receiving chemotherapy] |
| Categories | N.A. |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | Epocept |
| Company | Lupin pharma |
| Brand Discription | N.A. |
| Prescribed for | To treat anaemia associated with chronic renal failure and cancer chemotherapy. Anaemia associated with Zidovudine therapy in AIDS patients can also be treated with it. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearnce | N.A. |
| Route of Administration | Injection |
| Recommended Dosage | Starts with 25 to 50 i.u./kg over 1 to 2 minutes; thrice weekly. Increases the dosage in increments of 25 i.u./kg at intervals of four week. |
| Contraindication | Pregnancy and old age |
| Side Effects | Nausea, stomach upset, skin rashes and acute toxicity |
| Useful Link | http://www.medclik.com/General/pages/Drugmanual/BrandSearch/EPOCEPT.asp |
| PubMed ID | 20369312, 18208642 |
| 3-D Structure | Th1013 (View) or (Download) |