| Primary information |
|---|
| ThPP ID | Th1004 |
| Therapeutic Peptide/Protein Name | Denileukin diftitox |
| Sequence | MGADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDD view full sequnce in fasta |
| Functional Classification | IIb |
| Molecular Weight | 57647.3 |
| Chemical Formula | C2560H4042N678O799S17 |
| Isoelectric Point | 5.45 |
| Hydrophobicity | -0.301 |
| Melting Point (℃) | N.A. |
| Half Life | 1.16-1.3 hours |
| Description | A recombinant (using E. coli expression system) DNA-derived cytotoxic protein containing amino acid sequences for diphtheria toxin fragments A and B (Met 1-Thr 387)-His and sequences for interleukin-2 (Ala 1-Thr 133). |
| Indication/Disease | Used in the treatment of cutaneous T-cell lymphoma. |
| Pharmacodynamics | Denileukin diftitox (Ontak) uses the cytocidal action of diphtheria toxin on cells which express the IL-2 receptor. The human IL-2 receptor exists in three forms on basis of affinity, low (CD25), intermediate (CD122/CD132) and high (CD25/CD122/CD132). Malignant cells expressing one or more of the subunits of the IL-2 receptor are found in certain leukemias and lymphomas including cutaneous T-cell lymphoma (CTCL). Ontak interacts with the high affinity IL-2 receptor on the cell surface and inhibits cellular protein synthesis, resulting in cell death within hours. |
| Mechanism of Action | Denileukin diftitox binds to the high-affinity IL-2 receptor. The IL-2 receptor (Tac) subunit is expressed on activated lymphocytes. The diphtheria toxin associated with Ontak selectively kills the IL-2 bearing cells. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | 0.06 to 0.09 L/kg |
| Clearance | 0.6 - 2.0 mL/min/kg [Lymphoma] |
| Categories | Antineoplastic Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | Rilonacept decreases effects of toxoids by pharmacodynamic antagonism |
| Target | Interleukin-2 receptor subunit alpha,Interleukin-2 receptor subunit beta,Cytokine receptor common subunit gamma |
| Information of corresponding available drug in the market |
|---|
| Brand Name | Ontak |
| Company | Seragen Inc |
| Brand Discription | Ontak is a recombinant DNA-derived cytotoxic protein composed of the amino acid sequences of diphtheria toxin fragments A and B (Met1-Thr387)-His followed by sequences for human interleukin-2 (IL-2; Ala1-Thr133) |
| Prescribed for | Treating leukemia and lymphomas, including cutaneous (of the skin) T-cell lymphoma. |
| Chemical Name | N.A. |
| Formulation | Ontak contains 300 mcg of recombinant denileukin diftitox in a sterile solution of citric acid (20 mM), EDTA (0.05 mM) and polysorbate 20 ( < 1%) in Water for Injection, USP. The solution has a pH range of 6.9-7.2. |
| Physcial Appearnce | Sterile, white, preservative-free, lyophilized powder. |
| Route of Administration | Intravenous (Intravenous) administration |
| Recommended Dosage | N.A. |
| Contraindication | allergic |
| Side Effects | Common side effects include:headache, dizziness, or nervousness, numbness or tingling, skin itching or rash, runny or stuffy nose; weight gain or loss; mild diarrhea or constipation, or nausea, vomiting, loss of appetite. |
| Useful Link | http://www.drugs.com/mtm/ontak.html |
| PubMed ID | 17454642, 17187516 |
| 3-D Structure | Th1004 (View) or (Download) |