This page display detail information about a peptide. Following is detail description of peptide having ID: satpdb28026. One may get more information on these peptides by clicking on source of information (Link to Source). This page also allow to visulaize or download tertiary structure of this peptide.
| Field/Function | Detailed desription |
|---|---|
| Peptide ID | satpdb28026 |
| Sequence | GLMSLFRGVLKTAGKHIFKNVGGSLLDQAKCKITGEC |
| C-terminal modification | Free |
| N-terminal modification | Free |
| Peptide Type | Linear |
| Type of Modification | None |
| Source (Databases) | 5 (apd2, camp, dadp, hemolytik, yadamp) |
| Link to Source | apd2_AP01254, camp_CAMPSQ3344, dadp_47-SP_2632, hemolytik_1990, yadamp_1564, |
| Major Functions | 4 (antibacterial, toxic, antimicrobial, antifungal,) |
| Sub-functions | hemolytic |
| Additional Info | NA, |
| Helix (%) | 70.3 |
| Strand (%) | 0 |
| Coil (%) | 10.8 |
| Turn (%) | 18.9 |
| DSSP states | CCGGGHHHHHHHHHTTHHHHTTTSGGGGHHHHHHSCC |
| Tertiary Structure (Technique) | View in Jmol  OR Download Structure (Homology based) |