This page display detail information about a peptide. Following is detail description of peptide having ID: satpdb24729. One may get more information on these peptides by clicking on source of information (Link to Source). This page also allow to visulaize or download tertiary structure of this peptide.
| Field/Function | Detailed desription |
|---|---|
| Peptide ID | satpdb24729 |
| Sequence | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK |
| C-terminal modification | Free |
| N-terminal modification | Free |
| Peptide Type | Linear |
| Type of Modification | None |
| Source (Databases) | 7 (avpdb, camp, cancerppd, hemolytik, hipdb, parapep, yadamp) |
| Link to Source | avpdb_AVP1248, camp_CAMPSQ56, cancerppd_5007, cancerppd_5008, cancerppd_5009, cancerppd_5010, hemolytik_2445, hipdb_HIP961, parapep_1244, yadamp_1586, |
| Major Functions | 6 (anticancer, antibacterial, antiviral, antiparasitic, toxic, antimicrobial,) |
| Sub-functions | hemolytic, antileishmania |
| Additional Info | NA, |
| Helix (%) | 86.5 |
| Strand (%) | 0 |
| Coil (%) | 10.8 |
| Turn (%) | 2.7 |
| DSSP states | CHHHHHHHHHHHHHHHHHHHHTCCHHHHHHHHHHHHC |
| Tertiary Structure (Technique) | View in Jmol OR Download Structure (Homology based) |