This page display detail information about a peptide. Following is detail description of peptide having ID: satpdb24629. One may get more information on these peptides by clicking on source of information (Link to Source). This page also allow to visulaize or download tertiary structure of this peptide.
| Field/Function | Detailed desription |
|---|---|
| Peptide ID | satpdb24629 |
| Sequence | GKVWDWIKSAAKKIWSSEPVSQLKGQVLNAAKNYVAEKIGATPT |
| C-terminal modification | Free |
| N-terminal modification | Free |
| Peptide Type | Linear |
| Type of Modification | None |
| Source (Databases) | 4 (apd2, camp, hemolytik, yadamp) |
| Link to Source | apd2_AP00562, camp_CAMPSQ295, hemolytik_2188, hemolytik_2189, hemolytik_2190, hemolytik_2348, hemolytik_2349, hemolytik_2350, hemolytik_3549, hemolytik_3550, hemolytik_3551, hemolytik_3552, hemolytik_3553, yadamp_1839, |
| Major Functions | 3 (antibacterial, toxic, antimicrobial,) |
| Sub-functions | hemolytic, anti-gram+, cytotoxic, anti-gram- |
| Additional Info | insecticidal, |
| Helix (%) | 18.2 |
| Strand (%) | 0 |
| Coil (%) | 52.3 |
| Turn (%) | 29.5 |
| DSSP states | CCCCCCCCCSCCSCCCCCSSCTTTTHHHHHHHHTTTTTCCCCCC |
| Tertiary Structure (Technique) | View in Jmol OR Download Structure (Homology based) |