This page display detail information about a peptide. Following is detail description of peptide having ID: satpdb19282. One may get more information on these peptides by clicking on source of information (Link to Source). This page also allow to visulaize or download tertiary structure of this peptide.
| Field/Function | Detailed desription |
|---|---|
| Peptide ID | satpdb19282 |
| Sequence | AIKLVQSPNGNFAASFVLDGTKWIFKSKYYDSSKGYWVGIYEVWDRK |
| C-terminal modification | Free |
| N-terminal modification | Free |
| Peptide Type | Linear |
| Type of Modification | None |
| Source (Databases) | 4 (apd2, bactibase, camp, yadamp) |
| Link to Source | apd2_AP01154, bactibase_BAC212, camp_CAMPSQ1074, yadamp_1890, |
| Major Functions | 2 (antibacterial, antimicrobial,) |
| Sub-functions | anti-gram+, anti-gram- |
| Additional Info | NA, |
| Helix (%) | 0 |
| Strand (%) | 57.4 |
| Coil (%) | 23.4 |
| Turn (%) | 19.1 |
| DSSP states | CCEEEEETTCCCCCEEEETTEEEEEEEEEEETTTTEEEEEEESCCCC |
| Tertiary Structure (Technique) | View in Jmol OR Download Structure (Experimentally determined structure from PDB) |