This page display detail information about a peptide. Following is detail description of peptide having ID: satpdb17632. One may get more information on these peptides by clicking on source of information (Link to Source). This page also allow to visulaize or download tertiary structure of this peptide.
| Field/Function | Detailed desription |
|---|---|
| Peptide ID | satpdb17632 |
| Sequence | GIFPKIIGKGIVNGIKSLAKGVGMKVFKAGLNNIGNTGCNNRDEC |
| C-terminal modification | Free |
| N-terminal modification | Free |
| Peptide Type | Linear |
| Type of Modification | None |
| Source (Databases) | 6 (apd2, camp, dadp, hemolytik, hipdb, yadamp) |
| Link to Source | apd2_AP01271, camp_CAMPSQ3353, dadp_113-SP_2698, hemolytik_2477, hipdb_HIP930, yadamp_1860, |
| Major Functions | 4 (antibacterial, antiviral, toxic, antimicrobial,) |
| Sub-functions | hemolytic, anti-gram- |
| Additional Info | NA, |
| Helix (%) | 40 |
| Strand (%) | 0 |
| Coil (%) | 31.1 |
| Turn (%) | 28.9 |
| DSSP states | CCCCCCCCSSCHHHHHHHHHHHHHHHHHHSSCSSSSSCCCSTTTC |
| Tertiary Structure (Technique) | View in Jmol OR Download Structure (Homology based) |