Peptide Card of SATpdb

This page display detail information about a peptide. Following is detail description of peptide having ID: satpdb14268. One may get more information on these peptides by clicking on source of information (Link to Source). This page also allow to visulaize or download tertiary structure of this peptide.

Field/FunctionDetailed desription
Peptide IDsatpdb14268
Sequencegiriipviipgykkwarlikrglsrlgg
C-terminal modificationFree
N-terminal modificationFree
Peptide TypeLinear
Type of ModificationNone
Source (Databases)1 (parapep)
Link to Sourceparapep_1291,
Major Functions2 (antiparasitic, antimicrobial,)
Sub-functionsantileishmania
Additional InfoNA,
Helix (%)39.3
Strand (%)0
Coil (%)39.3
Turn (%)21.4
DSSP statesCCCCCCTTSCTHHHHHHHHHHHTTCCCC
Tertiary Structure
(Technique)
View in Jmol  OR Download Structure
 (PEPstrMOD)