This page display detail information about a peptide. Following is detail description of peptide having ID: satpdb11369. One may get more information on these peptides by clicking on source of information (Link to Source). This page also allow to visulaize or download tertiary structure of this peptide.
| Field/Function | Detailed desription |
|---|---|
| Peptide ID | satpdb11369 |
| Sequence | RICRRRSAGFKGPCVSNKNCAQVCMQEGWGGGNCDGPLRRCKCMRRC |
| C-terminal modification | Free |
| N-terminal modification | Free |
| Peptide Type | Linear |
| Type of Modification | None |
| Source (Databases) | 3 (apd2, camp, phytamp) |
| Link to Source | apd2_AP00721, camp_CAMPSQ3068, phytamp_PHYT00030, |
| Major Functions | 1 (antimicrobial,) |
| Sub-functions | NA |
| Additional Info | NA, |
| Helix (%) | 23.4 |
| Strand (%) | 36.2 |
| Coil (%) | 17 |
| Turn (%) | 23.4 |
| DSSP states | CEEEEECTTCCSSCSCHHHHHHHHHHHTCSEEEEETTTTEEEEEEEC |
| Tertiary Structure (Technique) | View in Jmol OR Download Structure (Experimentally determined structure from PDB) |