This page display detail information about a peptide. Following is detail description of peptide having ID: satpdb11339. One may get more information on these peptides by clicking on source of information (Link to Source). This page also allow to visulaize or download tertiary structure of this peptide.
| Field/Function | Detailed desription |
|---|---|
| Peptide ID | satpdb11339 |
| Sequence | QKLCEKPSGTWSGVCGNSNACKNQCINLEGAKHGSCNYVFPAHKCICYVP |
| C-terminal modification | Free |
| N-terminal modification | Free |
| Peptide Type | Linear |
| Type of Modification | None |
| Source (Databases) | 1 (yadamp) |
| Link to Source | yadamp_1935, |
| Major Functions | 1 (antimicrobial,) |
| Sub-functions | NA |
| Additional Info | NA, |
| Helix (%) | 22 |
| Strand (%) | 36 |
| Coil (%) | 24 |
| Turn (%) | 18 |
| DSSP states | CCCEEEECSSCCSBCSCHHHHHHHHHHHSCCSEEEEEECSSSEEEEEEEC |
| Tertiary Structure (Technique) | View in Jmol  OR Download Structure (Homology based) |