This page display detail information about a peptide. Following is detail description of peptide having ID: satpdb10044. One may get more information on these peptides by clicking on source of information (Link to Source). This page also allow to visulaize or download tertiary structure of this peptide.
| Field/Function | Detailed desription |
|---|---|
| Peptide ID | satpdb10044 |
| Sequence | ZDDRTFPCNSGRCACQPLDSYSYTCQSPSSSTANCKNNVCVSEADW |
| C-terminal modification | Free |
| N-terminal modification | Free |
| Peptide Type | Linear |
| Type of Modification | Z=pyroglutamic acid |
| Source (Databases) | 1 (conoserver) |
| Link to Source | conoserver_P04145, |
| Major Functions | 1 (miscellaneous,) |
| Sub-functions | NA |
| Additional Info | NA, |
| Helix (%) | NA |
| Strand (%) | NA |
| Coil (%) | NA |
| Turn (%) | NA |
| DSSP states | NA |
| 3-D Structure | Not Predicted |