Output of option Peptide Property of Browse Menu

This page list peptide entries having specific physico-chemical properties as selected by the user. The header of the table has abbreviations which are explained just above the starting of the table. Moreover, each column of the table can be sorted by clicking on the header of that column. Clicking once will display the results in descending order while clicking twice will display in ascending order. For example, if a user wants to get peptide sequences having maximum length (column 'Len') then he/she needs to sort 'Len' column by cliking on 'Len' header. User may get detailed information about a peptide by clicking its ID (left column labeled S-ID).

Search results of property wise browsing (Small sized residues between 0-25%)

S-ID: SATPdb ID; Seq: Sequence; Len: Length; HR: (%)Hydrophobic Residues; PR: (%)Polar Residues; Pos:(%) Positive Residues; Neg:(%) Negative Residues; SS:(%) Small size Residues;

The total number of entries retured by search is 4953

S-ID	Sequence	Len	HR	PR	Pos	Neg	SS
satpdb11232	DLADQLIHLYYFDCF	15	67	47	0	20	13
satpdb11233	LTDVEN	6	33	67	0	33	17
satpdb11234	PKLLKTFLKWIG	12	58	33	25	0	25
satpdb11239	GKVLDKFGKIVGKVLKQLKKVSAVAKV	27	48	41	30	4	22
satpdb11241	SWLRDIWDWICEV	13	54	38	8	23	15
satpdb11245	KPWERE	6	33	67	33	33	17
satpdb11246	RRRRRRRR	8	0	100	100	0	0
satpdb11252	LPNYNWNSFGLRF	13	54	46	8	0	23
satpdb11254	PRFWEYWLRLAE	12	67	42	17	17	17
satpdb11255	AVLDILKDVGKGLLSHFMEKV	21	52	38	14	14	19
satpdb11256	VKLFPWWNQY	10	70	40	10	0	10
satpdb11264	YKWL	4	75	50	25	0	0
satpdb11268	rrrrrrr	7	0	100	100	0	0
satpdb11270	DIRHRINNSIWRDIFLKRK	19	42	63	32	11	5
satpdb11276	RAIKIWFQNRRMKWKK	16	38	56	44	0	6
satpdb11283	KLKFKLKQ	8	38	63	50	0	0
satpdb11294	MIIYRDL	7	57	43	14	14	0
satpdb11295	IVF	3	100	0	0	0	0
satpdb11304	KKKKVVAAFYVLV	13	69	38	31	0	15
satpdb11311	CTEEHIVATELVIQEMYIKINVKNSP	26	46	54	8	15	23
satpdb11315	DDIVPC-OH	9	44	33	0	22	22
satpdb11316	yPVKLyPVKL	10	80	40	20	0	20
satpdb11317	MDFLI	5	60	20	0	20	0
satpdb11319	GRFKRFRKKFKKLFKKLS	18	33	61	56	0	11
satpdb11325	RVCFLWQDGRCVF	13	46	31	15	8	23
satpdb11326	NLLQFAFMIRQANKRRRPVIPYEEYGLYYM	30	53	50	17	7	17
satpdb11329	MIIYRDLIA	9	67	33	11	11	11
satpdb11333	fCYwKVCW	8	63	25	13	0	25
satpdb11336	LNWGAVLKHVVK	12	67	33	17	0	17
satpdb11337	RLGDILQKAREKIEGGLKKLVQKIKDFFGK FAPRTES	37	38	51	27	14	24
satpdb11338	WDLAWMFRLPVG	12	67	17	8	8	25
satpdb11343	AKKVFKRLEKLFSKIQNDK	19	37	63	37	11	11
satpdb11350	QEYTGWMDF	9	33	56	0	22	22
satpdb11351	EI	2	50	50	0	50	0
satpdb11352	KAΔFWKΔFVKΔFAK	17	41	24	24	0	12
satpdb11353	KKKKVVAATYVLVK	14	57	50	36	0	21
satpdb11355	FREGD	5	20	60	20	40	20
satpdb11359	SLKDKVKSMGEKLKQYIQTWKAKF	24	33	63	29	8	21
satpdb11367	FSTKTRNWFSEHFKKVKEKLKDTFA	25	36	68	28	12	24
satpdb11371	FLHHIVGLIHHGLSLFGDRAD	21	67	38	5	10	24
satpdb11372	ESGRIKKEEFAEIMKICSTIEELRRQK	27	26	63	26	22	22
satpdb11374	ARLDVASEFRKKWNKWALSR	20	45	55	30	10	25
satpdb11375	HFLLTKVNLAKKIL	14	64	43	21	0	14
satpdb11377	F-Hph	5	80	40	0	0	20
satpdb11378	KWKLFKKIGPGKFLHSAKKF	20	50	45	35	0	25
satpdb11380	WI-D-pipecolinyl-L-2-amino-8-o xodecanoyl	40	38	23	0	10	15
satpdb11385	GFLSILKKVLKVMAHMK	17	53	35	24	0	18
satpdb11386	IRD	3	33	67	33	33	0
satpdb11387	YPLDL	5	80	40	0	20	20
satpdb11388	ILAWKWAWWAWRR	13	77	23	23	0	23

entries from 301 - 350