Output of option Peptide Property of Browse Menu

This page list peptide entries having specific physico-chemical properties as selected by the user. The header of the table has abbreviations which are explained just above the starting of the table. Moreover, each column of the table can be sorted by clicking on the header of that column. Clicking once will display the results in descending order while clicking twice will display in ascending order. For example, if a user wants to get peptide sequences having maximum length (column 'Len') then he/she needs to sort 'Len' column by cliking on 'Len' header. User may get detailed information about a peptide by clicking its ID (left column labeled S-ID).

Search results of property wise browsing (Hydrophobic residues between 51-75%)

S-ID: SATPdb ID; Seq: Sequence; Len: Length; HR: (%)Hydrophobic Residues; PR: (%)Polar Residues; Pos:(%) Positive Residues; Neg:(%) Negative Residues; SS:(%) Small size Residues;

The total number of entries retured by search is 5622

S-ID	Sequence	Len	HR	PR	Pos	Neg	SS
satpdb26412	FSLFFPYAALKWLRKLLKK	19	68	37	26	0	21
satpdb26415	KLLLKLLLK	9	67	33	33	0	0
satpdb26419	ISLLQAR	7	57	43	14	0	29
satpdb26422	LLQSW	5	60	40	0	0	20
satpdb26426	LEAIPMSIPPEVKFNAPFVF	20	70	25	5	10	35
satpdb26434	F-HPhe	6	67	50	0	17	17
satpdb26441	ELVNQIIEQLIKKEKVYLAW	20	55	50	15	15	5
satpdb26449	VGQPQYYQANGGFLI	15	53	40	0	0	33
satpdb26451	FLPFLIPALTSLISS	15	73	27	0	0	47
satpdb26452	IKKEKVYLAWVPAHK	15	67	47	27	7	20
satpdb26454	GLWSKIKAAGKEAAKAAAKAAGKAALNAVS EAV	33	58	33	18	6	55
satpdb26456	GLWRALWRALWRSLWKLKRKV	21	57	38	33	0	19
satpdb26458	RPPGFTPF	8	63	25	13	0	63
satpdb26459	FLPLLAGLAVNFLPKLFCKITRKC	24	63	25	17	0	33
satpdb26463	SILPTIVSFLTKF	13	62	38	8	0	38
satpdb26465	RRKKAAVALLPAVLLAKLAP	20	75	25	25	0	40
satpdb26470	GLLDIVTGLLGNLIVDVLKPKTPAS	25	56	32	8	8	36
satpdb26471	DAQEKRQPWLPFV	13	54	46	15	15	23
satpdb26472	LLPNLLKSLL	10	70	30	10	0	20
satpdb26473	RVISLPAGFSPFR	13	62	31	15	0	46
satpdb26485	DLRFLYPRGKLPVPTPPPFNPKPIYIDMGN RY	32	59	41	16	6	34
satpdb26486	YGAVVNDL	8	63	38	0	13	25
satpdb26491	VLGPVLGLVSNALGGLL	17	65	12	0	0	41
satpdb26501	KKKKLLAAFLFFF	13	69	31	31	0	15
satpdb26502	GLLDIVKKVVGAFGS	15	53	27	13	7	33
satpdb26507	LQP	3	67	33	0	0	33
satpdb26511	ILPLVGNLLNDL	12	67	25	0	8	17
satpdb26512	YNPCASYL	8	63	50	0	0	50
satpdb26515	JRWPHLEIPP	10	70	30	10	10	30
satpdb26516	KKKKVFAATYVLV	13	62	46	31	0	23
satpdb26520	PRPRPRPLPFPRPG	14	64	29	29	0	57
satpdb26522	FISGLIGGLMKAL	13	54	15	8	0	38
satpdb26529	MEWYPEAAANAERYTQIVWYK	21	57	52	10	14	29
satpdb26532	ILGPVISTIGNALGGLLKNL	20	55	25	5	0	40
satpdb26533	LLPIVGNLLNSLL	13	69	23	0	0	23
satpdb26538	F-hPhe	6	67	50	0	17	17
satpdb26543	AMKPWIQPK	9	56	33	22	0	33
satpdb26544	INLKAIAALAKKLLG	15	67	27	20	0	33
satpdb26546	CKFPLNAAC	9	56	22	11	0	56
satpdb26548	fvqwfskflGril	13	62	31	15	0	15
satpdb26553	KKllKLLlKlLK	12	58	42	42	0	0
satpdb26558	GKPRPYLPRPTSHPRPIRV	19	58	47	26	0	47
satpdb26560	KVLPVQ	6	67	33	17	0	17
satpdb26563	WNLNA	5	60	40	0	0	20
satpdb26564	ALWKTLLKKVLKAAA	15	67	33	27	0	33
satpdb26567	MIIYRAEISH	10	60	50	10	10	20
satpdb26571	LLGMIPLAISAISALSKL	18	67	22	6	0	44
satpdb26572	YNW	3	67	67	0	0	0
satpdb26575	QNSAAAFAQWA	11	64	36	0	0	55
satpdb26577	FMGGLIKAATKALPAAFCAITKKC	24	54	25	17	0	54

entries from 4801 - 4850