Output of option Peptide Property of Browse Menu

This page list peptide entries having specific physico-chemical properties as selected by the user. The header of the table has abbreviations which are explained just above the starting of the table. Moreover, each column of the table can be sorted by clicking on the header of that column. Clicking once will display the results in descending order while clicking twice will display in ascending order. For example, if a user wants to get peptide sequences having maximum length (column 'Len') then he/she needs to sort 'Len' column by cliking on 'Len' header. User may get detailed information about a peptide by clicking its ID (left column labeled S-ID).

Search results of property wise browsing (Hydrophobic residues between 51-75%)

S-ID: SATPdb ID; Seq: Sequence; Len: Length; HR: (%)Hydrophobic Residues; PR: (%)Polar Residues; Pos:(%) Positive Residues; Neg:(%) Negative Residues; SS:(%) Small size Residues;

The total number of entries retured by search is 5622

S-ID	Sequence	Len	HR	PR	Pos	Neg	SS
satpdb25924	ALWKNMLKGIGKLAGQAALGAVKTLVGA	28	54	25	14	0	43
satpdb25928	FLPVIAGVAANFLPKLFCAISKKC	24	67	21	13	0	42
satpdb25929	FLGWLFKWAWK	11	73	18	18	0	18
satpdb25930	CVLVTL	6	67	17	0	0	33
satpdb25931	FFPIVGKLLFGLFGLL	16	75	6	6	0	25
satpdb25932	GIIDIAKKLFESW	13	54	38	15	15	23
satpdb25933	IRYLPRG	7	57	43	29	0	29
satpdb25941	FLGGLMKIIPAAFCAVTKKC	20	55	20	15	0	45
satpdb25946	GLWRALWRLLRSLWRLLWKA	20	65	30	25	0	20
satpdb25948	WLGSALKIGAKLLPSVVGLFKKKKQ	25	52	36	24	0	32
satpdb25950	FVPWFSKFLGRiL	13	69	23	15	0	23
satpdb25951	FDKPVSPL	8	63	38	13	13	38
satpdb25952	TAPY	4	75	50	0	0	75
satpdb25955	JGRPPGPPIP	10	60	10	10	0	70
satpdb25957	ACWWAGIKAEF	11	64	18	9	9	45
satpdb25959	KWKKLLKKLLPLLKKLLKKLK	21	52	48	48	0	5
satpdb25960	AMKPW	5	60	20	20	0	40
satpdb25965	GILDAIKAIAKAAG	14	64	21	14	7	50
satpdb25970	KGLSGPSWWLFCV	13	54	23	8	0	46
satpdb25971	RRKKAVLLALLAP	13	69	31	31	0	31
satpdb25974	GIGGKILSGFKTALKGAAKELAFTYLH	27	52	37	15	4	44
satpdb25977	LTLWNEARKLNPNAI	15	53	47	13	7	27
satpdb25979	MAKFASIIVLLFVALVVFAAFEEPTMVEA	29	72	21	3	10	31
satpdb25981	KWKLFKKIPKFLHSAKKF	18	56	50	39	0	17
satpdb25983	KKKKVVAATYLLV	13	62	46	31	0	23
satpdb25994	KKALLOHPLHOLALLAOHLAHOLKKA	26	69	31	15	0	23
satpdb25998	GLLSVLGSVAKHVLPHVVPVIAEKL	25	72	28	8	4	32
satpdb26000	AAVALLPAVLLALLAKKNNLKECGLY	26	69	27	12	4	35
satpdb26008	CGAHHAADAHHAADAHHAADGC	22	68	41	0	14	59
satpdb26009	LLPPWLRPRNG	11	64	27	18	0	36
satpdb26017	ALRLAIRRR	9	56	44	44	0	22
satpdb26021	GVLDILKGAGKDLLAHALSKISEKV	25	52	40	16	12	32
satpdb26028	ALNCYWPLNDYGFYTTTGIGYQPYRVVVLS FEL	33	58	45	3	6	33
satpdb26033	FFPIVGKLLSGLSGL	15	60	20	7	0	40
satpdb26035	AFKLLGRIIHHVGNFVYGFSHVF	23	70	35	9	0	22
satpdb26041	GLVDVLGKVGGLIKKLLPG	19	53	21	16	5	32
satpdb26049	FAIAIKAIKKAIKKIKKAIKKAI	23	61	39	39	0	26
satpdb26050	GIGGKILSGLKTALKGAAKQLAATYLH	27	52	37	15	0	48
satpdb26054	FKVQNQHGQVVKIFHH	16	56	56	13	0	6
satpdb26056	APANSVWS	8	63	38	0	0	63
satpdb26072	TLLCDCPNGPWVWVPAFCQA	20	60	20	0	5	50
satpdb26073	IWLHSLGQHIYETYG	15	60	53	0	7	27
satpdb26076	FFPAIFRLVAKVVPSIICSVTKKC	24	63	29	17	0	38
satpdb26078	TEPAYQRFL	9	56	56	11	11	33
satpdb26079	FLPGLIAGIAKML	13	69	8	8	0	38
satpdb26080	MGAIAKLVAKFGWPFIKKFYKQIMQFIGQG WTIDQIEKWLKRH	43	51	40	19	5	21
satpdb26084	RRYaFEVVG	9	56	44	22	11	22
satpdb26089	ALYVGDLCGSVFLVGQLF	18	61	22	0	6	33
satpdb26092	FLSGIVGMLGKLF	13	54	15	8	0	31
satpdb26099	FAKLLAKLAKAKA	13	69	31	31	0	38

entries from 4651 - 4700