Output of option Peptide Property of Browse Menu

This page list peptide entries having specific physico-chemical properties as selected by the user. The header of the table has abbreviations which are explained just above the starting of the table. Moreover, each column of the table can be sorted by clicking on the header of that column. Clicking once will display the results in descending order while clicking twice will display in ascending order. For example, if a user wants to get peptide sequences having maximum length (column 'Len') then he/she needs to sort 'Len' column by cliking on 'Len' header. User may get detailed information about a peptide by clicking its ID (left column labeled S-ID).

Search results of property wise browsing (Hydrophobic residues between 51-75%)

S-ID: SATPdb ID; Seq: Sequence; Len: Length; HR: (%)Hydrophobic Residues; PR: (%)Polar Residues; Pos:(%) Positive Residues; Neg:(%) Negative Residues; SS:(%) Small size Residues;

The total number of entries retured by search is 5622

S-ID	Sequence	Len	HR	PR	Pos	Neg	SS
satpdb25728	ALWLAIRKR	9	67	33	33	0	22
satpdb25729	DAACAAKCLWR	11	55	27	18	9	55
satpdb25730	FLPKLFAKITKKNMAHIR	18	56	44	28	0	22
satpdb25732	GLRPPIRCKAAFC	13	54	23	23	0	54
satpdb25736	LNSAGYLLGKALAALAKKIL	20	65	30	15	0	40
satpdb25744	KVLPVPE	7	71	29	14	14	29
satpdb25746	LEAIPASIPPEVKFNKPFVF	20	70	30	10	10	35
satpdb25752	GLFDVIKKVASVIGLASP	18	61	28	11	6	39
satpdb25754	TPFKLSLHL	9	67	44	11	0	33
satpdb25761	ILGPVLGLVGSVLGGLLKNL	20	60	15	5	0	35
satpdb25766	AEDWVRWI	8	63	38	13	25	13
satpdb25767	FIGSALKVLAGVLPSVISWVKQ	22	64	27	9	0	36
satpdb25768	JKWALPKVPP	10	70	20	20	0	40
satpdb25773	YSPITNF	7	57	57	0	0	43
satpdb25780	GCPWHPWC	8	63	13	0	0	63
satpdb25781	GLLGFVGSLLGGLGI	15	53	7	0	0	47
satpdb25793	FLKVPAQNAISTTFPYT	17	59	47	6	0	47
satpdb25796	SDLPFEH	7	57	57	0	29	29
satpdb25807	ALVLIAFAQVLQQCP	15	73	20	0	0	33
satpdb25808	AWKVFKRLGIGAVLWVLTWG	20	65	20	15	0	30
satpdb25818	VPKVK	5	60	40	40	0	20
satpdb25823	LLRISLLLIQSWLE	14	64	36	7	7	14
satpdb25824	YLYEIARR	8	63	63	25	13	13
satpdb25827	DCQGEWEFCIVPVLGFVYCCPWLICGPFVC VDI	33	58	18	0	12	36
satpdb25828	AEPVAML	7	71	14	0	14	43
satpdb25829	KLLAKAALKWLLKALKAA	18	72	28	28	0	33
satpdb25830	QADFQKVVAGVANALAHRYH	20	65	45	10	5	30
satpdb25831	PQTLALP	7	71	29	0	0	57
satpdb25838	ILGPVLGLVSRTLRRVLGIL	20	60	25	15	0	30
satpdb25839	NAAKYNPCASYL	12	58	50	8	0	50
satpdb25844	ILGPVLGLVGNALGGLIKNE	20	55	20	5	5	35
satpdb25846	AFVKGSAQRVAHGY	14	57	43	14	0	43
satpdb25849	FRWWHR	6	67	50	33	0	0
satpdb25851	GLFDIVKKVVGALGS	15	53	27	13	7	33
satpdb25865	VRRFPWWWPFLRR	13	69	31	31	0	15
satpdb25876	GFWGKLFKLGLHGIGLLHLH	20	65	25	10	0	25
satpdb25879	VALALKALKKALKKLKKALKKAL	23	61	39	39	0	26
satpdb25883	ATAVDFGPHGLLPIRPIRIRPLCGKDKS	28	54	36	18	7	43
satpdb25886	QlLVDlI	7	71	29	0	14	0
satpdb25892	GLLASLGKVFGGYLAEKLKPK	21	52	33	19	5	38
satpdb25895	FIGPIISALASLFG	14	71	14	0	0	50
satpdb25899	IPT	3	67	33	0	0	67
satpdb25900	RPP	3	67	33	33	0	67
satpdb25901	VDARSVYPYDEFVLA	15	67	47	7	20	27
satpdb25909	DDEVEIIVL	9	56	44	0	44	0
satpdb25910	NNLLRAIEAQQHLLQLTVWGIKQLQARILA VERYLKDQ	38	53	50	13	8	16
satpdb25916	SRWPSPGRPRPFPGRPKPIFRPRPCNCYAP PCPCDRW	37	51	35	22	3	57
satpdb25917	IEP	3	67	33	0	33	33
satpdb25921	WYSL	4	75	50	0	0	25
satpdb25923	PTHKAW	6	67	50	17	0	50

entries from 4601 - 4650