Output of option Peptide Property of Browse Menu

This page list peptide entries having specific physico-chemical properties as selected by the user. The header of the table has abbreviations which are explained just above the starting of the table. Moreover, each column of the table can be sorted by clicking on the header of that column. Clicking once will display the results in descending order while clicking twice will display in ascending order. For example, if a user wants to get peptide sequences having maximum length (column 'Len') then he/she needs to sort 'Len' column by cliking on 'Len' header. User may get detailed information about a peptide by clicking its ID (left column labeled S-ID).

Search results of property wise browsing (Hydrophobic residues between 51-75%)

S-ID: SATPdb ID; Seq: Sequence; Len: Length; HR: (%)Hydrophobic Residues; PR: (%)Polar Residues; Pos:(%) Positive Residues; Neg:(%) Negative Residues; SS:(%) Small size Residues;

The total number of entries retured by search is 5622

S-ID	Sequence	Len	HR	PR	Pos	Neg	SS
satpdb25544	PPGTGEEPEQAGLPPPELLVEPDYMWSPP	29	55	34	0	21	52
satpdb25545	VKAGF	5	60	20	20	0	40
satpdb25550	GVLLLILCLPTLVDCIRNCI	20	60	20	5	5	30
satpdb25551	VQLRRIRVWVIR	12	58	42	33	0	0
satpdb25552	ILGKLLSTAWGLLSKL	16	56	31	13	0	38
satpdb25565	VWPLGLVICKALKIC	15	67	13	13	0	33
satpdb25566	IFGAIWNGIKSLF	13	62	23	8	0	31
satpdb25568	LSPA	4	75	25	0	0	75
satpdb25572	AYVLDEPK	8	63	50	13	25	25
satpdb25576	KKKKVLLPFLFVF	13	69	31	31	0	8
satpdb25577	GLLGLLGSVVSHVLPAITQHL	21	67	29	0	0	38
satpdb25586	RRKKLALLAP	10	60	40	40	0	30
satpdb25594	PGL	3	67	0	0	0	67
satpdb25598	INWKGIAAMAKKLL	14	57	29	21	0	29
satpdb25600	ALWKNMLKGIGKLAGQAALGAVKTLVGAE	29	52	28	14	3	41
satpdb25607	APPGFTPFRSK	11	55	36	18	0	64
satpdb25609	PGTAVFK	7	57	29	14	0	57
satpdb25610	GRQGCYEHLWRLIAWCAIFL	20	60	30	10	5	30
satpdb25612	GFFALIPKIISSPLFKTLLSAV	22	68	27	9	0	41
satpdb25616	KVGSLQYLALAALIT	15	67	33	7	0	40
satpdb25617	ALLLAIRRR	9	67	33	33	0	22
satpdb25620	AAKKLSKLLKTLLKLL	16	56	44	31	0	25
satpdb25626	LTVQPWP	7	71	29	0	0	43
satpdb25640	GMWSTIRNVGKSAAKAANLPAKAALGAISE AV	32	53	34	13	3	53
satpdb25641	LLGLVTGACCAVLKFSFCC	19	53	16	5	0	53
satpdb25642	CACIADHSH	9	56	44	0	11	56
satpdb25643	FFGWLIKGAIHAGKAIHGLIHRRRH	25	64	36	20	0	28
satpdb25663	QIPWFHR	7	71	43	14	0	14
satpdb25664	VILSLDVPIGLLRILLEQARYKAARNQAAT NAQILAHV	38	63	39	11	5	29
satpdb25668	GLGSVLGKALKIGANLL	17	53	24	12	0	41
satpdb25669	LLPIVGNLLKSL	12	67	25	8	0	25
satpdb25670	KWKLFKKPKFLHLAKKF	17	59	47	41	0	12
satpdb25675	CIVEEVDARSVYPYD	15	53	53	7	27	27
satpdb25681	QKAASRLLRALSKLLEAF	18	56	44	22	6	33
satpdb25682	WGNVlL	6	67	17	0	0	17
satpdb25684	RRKKAAVALLKAVLLAALAP	20	75	25	25	0	40
satpdb25685	FLRQNLAF	8	63	38	13	0	13
satpdb25687	ELYENKPRRPYIL	13	54	62	23	15	15
satpdb25688	YMFHLMD	7	57	43	0	14	0
satpdb25690	FLPLIGKILGTI	12	67	17	8	0	33
satpdb25693	GIGKFLHAAKKFAKAFVAEIMNS	23	57	35	17	4	35
satpdb25695	FLVMFLSG	8	63	13	0	0	25
satpdb25696	FLAAARIAKRVAKKARKLAKRAARKRK	27	52	48	48	0	33
satpdb25698	SMPINSPYIPWS	12	58	42	0	0	50
satpdb25704	ALWKTLLKKVLKA	13	62	38	31	0	23
satpdb25706	FFSMIPKIATGIASLVKNL	19	58	32	11	0	37
satpdb25709	vfwrrirvwvir	12	67	33	33	0	0
satpdb25718	CHHNLTHAC	9	56	56	0	0	44
satpdb25722	INWKKLLDAAKQIL	14	57	43	21	7	14
satpdb25725	YbetaAGAVVNDL	13	54	38	0	15	38

entries from 4551 - 4600