Output of option Peptide Property of Browse Menu

This page list peptide entries having specific physico-chemical properties as selected by the user. The header of the table has abbreviations which are explained just above the starting of the table. Moreover, each column of the table can be sorted by clicking on the header of that column. Clicking once will display the results in descending order while clicking twice will display in ascending order. For example, if a user wants to get peptide sequences having maximum length (column 'Len') then he/she needs to sort 'Len' column by cliking on 'Len' header. User may get detailed information about a peptide by clicking its ID (left column labeled S-ID).

Search results of property wise browsing (Hydrophobic residues between 51-75%)

S-ID: SATPdb ID; Seq: Sequence; Len: Length; HR: (%)Hydrophobic Residues; PR: (%)Polar Residues; Pos:(%) Positive Residues; Neg:(%) Negative Residues; SS:(%) Small size Residues;

The total number of entries retured by search is 5622

S-ID	Sequence	Len	HR	PR	Pos	Neg	SS
satpdb24987	CYGFGEACLVLYTDCCGYCVLAVCL	25	52	24	0	8	48
satpdb24991	ILGPVISKIGGVLGGLLKN	19	53	21	11	0	37
satpdb24997	KAKLFKKIPKFLHLWKKF	18	61	44	39	0	11
satpdb24998	FFPIVGKLLS	10	70	20	10	0	30
satpdb25003	GVLDAFRKIATVVKNVV	17	59	35	18	6	24
satpdb25007	HEVVAG	6	67	33	0	17	33
satpdb25012	LNSAGYLLGKLKALAALAK	19	63	32	16	0	42
satpdb25014	FLGAIAGVAAKFLPKVFCFITKKC	24	63	21	17	0	42
satpdb25018	GWFGKAFRSVSNFYKKHKTYIHAGLSAATL	30	53	50	17	0	40
satpdb25020	AACKAACKKGAKLILKAAAPLASQVCGPAC NAALA	35	60	23	14	0	63
satpdb25027	GIGGKILGGFKTALKGAAKELAATYLH	27	52	33	15	4	48
satpdb25029	KKKKLVLPFLFVF	13	69	31	31	0	8
satpdb25031	FAKWAFKWLKK	11	64	36	36	0	18
satpdb25033	YYRA	4	75	75	25	0	25
satpdb25038	KKKKVVAATYVLFA	14	64	43	29	0	29
satpdb25039	LKLkLfPLKLKLfP	14	71	29	29	0	14
satpdb25041	ACFWKYCV	8	63	25	13	0	38
satpdb25043	VkLKVyPLKVKLyP	14	71	43	29	0	14
satpdb25044	JGWPGPKVPP	10	60	10	10	0	60
satpdb25053	FLGALFKALSKLL	13	69	23	15	0	31
satpdb25055	FLPFIAGMAANFLPKIFCAISKKC	24	63	21	13	0	42
satpdb25057	FLPILAGLAANILPKVFCSITKKC	24	63	25	13	0	42
satpdb25058	VIGSILGALASGLPTLISWIKNR	23	57	30	9	0	43
satpdb25059	YaFQvVG	7	71	29	0	0	29
satpdb25061	SIFPAIVSFLSKFL	14	71	29	7	0	36
satpdb25064	AQL	3	67	33	0	0	33
satpdb25065	DFKLFAVTIKYR	12	58	50	25	8	17
satpdb25070	YAFGYPS	7	71	43	0	0	57
satpdb25072	ALRLAIRKR	9	56	44	44	0	22
satpdb25076	GFVDLAKKVVGGIRNALGI	19	53	26	16	5	32
satpdb25083	JKWPPGKVPP	10	60	20	20	0	50
satpdb25084	FRVPTPN	7	57	43	14	0	43
satpdb25095	GLEESPGHPGQPGPPGPPGAPGP	23	52	22	0	9	78
satpdb25097	TKVIP	5	60	40	20	0	40
satpdb25098	INWKKIAEIGKQVLSAL	17	53	41	18	6	24
satpdb25100	PALNCYWPLNDYGFYTTSGI	20	55	45	0	5	45
satpdb25103	NWRKILGQIASVGAGLLGSLLAGYE	25	52	32	8	4	40
satpdb25110	LEAIAMSIPPEVKFNKPFVF	20	65	30	10	10	30
satpdb25119	FLPLVTMLLGKLF	13	69	15	8	0	23
satpdb25128	HFLGKLVNLAKKIL	14	64	36	21	0	14
satpdb25131	FFPIVGKLLFGLSGLL	16	69	13	6	0	31
satpdb25133	QPIIITSPYLPS	12	67	42	0	0	50
satpdb25136	MGLGLHLLVLAAALQGAWSQPKKKRKV	27	56	33	19	0	33
satpdb25144	IIIQYEGHKH	10	60	60	10	10	10
satpdb25148	YKLFKKILKKL	11	55	55	45	0	0
satpdb25150	GCCSHPVCHARHPALC	16	56	31	6	0	63
satpdb25151	VLPLISMALGKL	12	67	17	8	0	33
satpdb25158	FIGPVLKIATSILPTAICKIFKKC	24	58	29	17	0	42
satpdb25161	ADVPGNYPLNSYGASYYCTI	20	55	50	0	5	50
satpdb25162	KKKKVVAATYVKV	13	54	54	38	0	23

entries from 4401 - 4450