Output of option Peptide Property of Browse Menu

This page list peptide entries having specific physico-chemical properties as selected by the user. The header of the table has abbreviations which are explained just above the starting of the table. Moreover, each column of the table can be sorted by clicking on the header of that column. Clicking once will display the results in descending order while clicking twice will display in ascending order. For example, if a user wants to get peptide sequences having maximum length (column 'Len') then he/she needs to sort 'Len' column by cliking on 'Len' header. User may get detailed information about a peptide by clicking its ID (left column labeled S-ID).

Search results of property wise browsing (Hydrophobic residues between 51-75%)

S-ID: SATPdb ID; Seq: Sequence; Len: Length; HR: (%)Hydrophobic Residues; PR: (%)Polar Residues; Pos:(%) Positive Residues; Neg:(%) Negative Residues; SS:(%) Small size Residues;

The total number of entries retured by search is 5622

S-ID	Sequence	Len	HR	PR	Pos	Neg	SS
satpdb24610	GKPRPYSPRPTSHPRPIRV	19	53	53	26	0	53
satpdb24619	GLLGLLGSVVSHVVPAIVGHF	21	71	19	0	0	38
satpdb24621	ACSKKWEYCIVPILGFVYCCPGLNLWSFRL RLIVMSSTPICATLA	45	56	31	9	2	42
satpdb24623	AWYRGAAPPKQEFLDIEDP	19	58	42	11	21	37
satpdb24626	LLPNLLKSLL	10	70	30	10	0	20
satpdb24627	KKKKKKAAFAAFAAFAA	17	65	35	35	0	47
satpdb24635	PRFWEYWLRAME	12	58	42	17	17	17
satpdb24637	LKWLKKWLK	9	56	44	44	0	0
satpdb24638	b-KLAKLALKALKAALKLA-amide	25	56	28	20	8	28
satpdb24646	ALWMTLLKKVLK	12	58	33	25	0	17
satpdb24648	KKLFKKILkYL	11	55	55	45	0	0
satpdb24650	PPWCCCSPMKRASPPPAQSDLPATPKCPP	29	52	31	10	3	72
satpdb24651	AILTTLANWARKFLGK	16	56	38	19	0	38
satpdb24662	FLGGLLSSIFGHLGK	15	53	27	7	0	40
satpdb24663	ALLDKLKSLGKVVGKVALGVVQNYLNPRQ	29	52	41	17	3	24
satpdb24667	VIPSVASVAAEMMQHVYCAASKKC	24	54	38	8	4	46
satpdb24669	KFLGTLVNLAKKIL	14	57	36	21	0	21
satpdb24677	MIFPGGPQL	9	56	11	0	0	44
satpdb24680	GLFDIIKNIFSGL	13	54	31	8	8	23
satpdb24683	VNWKKILGKIIKVAK	15	53	40	33	0	13
satpdb24686	RVRVFVVHIPRLT	13	69	38	23	0	15
satpdb24688	FAKKFAKKFKKFAKKFAKFAFAF	23	61	39	39	0	26
satpdb24691	FPLALLCKVFKKC	13	62	23	23	0	31
satpdb24693	HKEMPFPKYPVEPF	14	64	43	14	14	29
satpdb24696	ILGPVLGLVGNTLGGLIKKI	20	55	20	10	0	35
satpdb24697	CNIAPASIVSRNIVYTRAQPNQDIA	25	52	48	8	4	40
satpdb24699	YQLLIAMIYKNI	12	67	42	8	0	8
satpdb24703	SDLGAVISWGRQLFA	15	53	33	7	7	40
satpdb24707	GILDFAKTVVGGIRNALGI	19	53	26	11	5	37
satpdb24710	IKIPSFFRNILKKVGKEAVSLIAGALKQS	29	52	41	21	3	31
satpdb24712	NWGPLV	6	67	17	0	0	33
satpdb24713	GAIVSTALPQWRIYSYAG	18	61	39	6	0	50
satpdb24715	FLPAVLRVAAKIVPSVVCAITKKC	24	67	25	17	0	42
satpdb24716	FSLLPSLIGGLVSAIK	16	63	25	6	0	44
satpdb24719	PPG	3	67	0	0	0	100
satpdb24727	FIPGLRRLFATVVPTVVCAINKLPPG	26	65	23	12	0	42
satpdb24728	YAPWTNA	7	71	43	0	0	57
satpdb24733	AMPKPW	6	67	17	17	0	50
satpdb24735	PAWRKAFRKAWRMLKKAA	18	56	39	39	0	33
satpdb24740	GIGAVLKVLTTGLPALISWI	20	65	20	5	0	45
satpdb24744	LLFLKVPAQNAISTTFPYT	19	63	42	5	0	42
satpdb24746	FAKKLAKKLAKLAL	14	64	36	36	0	29
satpdb24748	GLFDIIKKIAESI	13	54	38	15	15	23
satpdb24750	RPPGFSPFRIY	11	64	36	18	0	45
satpdb24754	NFGAPGGAYPW	11	64	18	0	0	64
satpdb24755	TKIVP	5	60	40	20	0	40
satpdb24761	GNRPVYIPPPRPPHPR	16	69	38	19	0	50
satpdb24763	ATMYYKDVTVSQVWF	15	53	53	7	7	27
satpdb24766	ALWMTLLKKVLKAAAKAALNAVLVGANA	28	68	25	14	0	39
satpdb24769	(Y)AGAVVNDL	11	55	27	0	9	27

entries from 4301 - 4350