Output of option Peptide Property of Browse Menu

This page list peptide entries having specific physico-chemical properties as selected by the user. The header of the table has abbreviations which are explained just above the starting of the table. Moreover, each column of the table can be sorted by clicking on the header of that column. Clicking once will display the results in descending order while clicking twice will display in ascending order. For example, if a user wants to get peptide sequences having maximum length (column 'Len') then he/she needs to sort 'Len' column by cliking on 'Len' header. User may get detailed information about a peptide by clicking its ID (left column labeled S-ID).

Search results of property wise browsing (Hydrophobic residues between 51-75%)

S-ID: SATPdb ID; Seq: Sequence; Len: Length; HR: (%)Hydrophobic Residues; PR: (%)Polar Residues; Pos:(%) Positive Residues; Neg:(%) Negative Residues; SS:(%) Small size Residues;

The total number of entries retured by search is 5622

S-ID	Sequence	Len	HR	PR	Pos	Neg	SS
satpdb23752	LGNWAREIWATL	12	58	33	8	8	33
satpdb23754	PFFDPQIP	8	75	25	0	13	38
satpdb23761	DAQEKRQPWIPFV	13	54	46	15	15	23
satpdb23762	CLSYYPSYC	9	56	56	0	0	56
satpdb23767	VWDPPKFD	8	63	38	13	25	25
satpdb23776	FLPVIAGVAAKFLPKIACAITKKC	24	67	21	17	0	46
satpdb23778	PAWFKARRWAWRMKKLAA	18	61	33	33	0	33
satpdb23783	GRILSFIKAGLAEHL	15	60	33	13	7	33
satpdb23794	FLPAIGRVLSGIL	13	69	15	8	0	38
satpdb23798	NPP	3	67	33	0	0	67
satpdb23802	KKKKLVLATYVLV	13	62	46	31	0	15
satpdb23806	GLPALILWIKRKRQQ	15	53	40	27	0	20
satpdb23808	LNWGAWLKHWWK	12	67	33	17	0	17
satpdb23812	LVPLPKIKNSTFT	13	54	46	15	0	38
satpdb23816	ALPQWRIYSYAGDNIVTA	18	61	44	6	6	39
satpdb23820	FFHHIFRGIVHVGKTIHKLVTG	22	64	41	14	0	23
satpdb23823	FAKFLAKFLKKAL	13	69	31	31	0	23
satpdb23826	FFVAPFEVFGK	11	73	18	9	9	27
satpdb23830	GIIKKIIIKKIIIKKIIIKKI	21	57	38	38	0	5
satpdb23831	VGLLLYCKARSTPVTLS	17	53	41	12	0	47
satpdb23836	TWAGVEAIIRILQQL	15	60	33	7	7	27
satpdb23842	FVPWFSKFLGRIL	13	69	23	15	0	23
satpdb23843	RWKIFKKIEKVGQNIRDGIVKAGPAVAVVG QAATI	35	51	37	20	6	31
satpdb23845	PTHIK	5	60	60	20	0	40
satpdb23847	GLWSTIKQKGKEAAIAAAKAAGQAALGA	28	54	32	14	4	57
satpdb23848	CSFTDYVLIWVKC	13	54	38	8	8	31
satpdb23853	INVLGILGLLGKALSHL	17	65	24	6	0	29
satpdb23856	CVNHPAFAC	9	67	22	0	0	56
satpdb23862	FFFLSRIF	8	75	25	13	0	13
satpdb23866	AKAWGIPPHVIPQIVPVRIRPLCGNV	26	69	23	12	0	38
satpdb23868	FLPGLIAGIAKM	12	67	8	8	0	42
satpdb23870	DCQALWDYCPVPFLSSGDCCIGLICGPFIC IGW	33	52	21	0	9	48
satpdb23871	INWLKLGKKILGA	13	54	31	23	0	23
satpdb23876	LKWLKKLLKKL	11	55	45	45	0	0
satpdb23880	ILGPVLGLVGNPLGGLIKKI	20	60	15	10	0	35
satpdb23883	FLFPLITSFLSKV	13	69	31	8	0	31
satpdb23886	LEAIPMSIPPEVKFNKPFVA	20	65	30	10	10	35
satpdb23890	FLPLIGKVLSGIL	13	69	15	8	0	31
satpdb23891	ALWKTLLKKVLKA	13	62	38	31	0	23
satpdb23892	AGLLDILGL	9	67	11	0	11	33
satpdb23900	LTFEHYWAQLTS	12	58	58	0	8	33
satpdb23905	WRWRWRWRW	9	56	44	44	0	0
satpdb23909	KFAYPQ	6	67	50	17	0	33
satpdb23914	INWLKLGKKLLSAL	14	57	36	21	0	21
satpdb23916	FWN	3	67	33	0	0	0
satpdb23917	EPFKLSLHL	9	67	44	11	11	22
satpdb23922	KW-Ape-W-Ape-WI	15	53	20	7	13	27
satpdb23931	EAVRHFPRIWLHSLG	15	67	40	13	7	27
satpdb23934	KKKKLVAAFYVLV	13	69	38	31	0	15
satpdb23939	LEAIPMSIPPEVFFNKPFVF	20	70	25	5	10	30

entries from 4051 - 4100