Output of option Peptide Property of Browse Menu

This page list peptide entries having specific physico-chemical properties as selected by the user. The header of the table has abbreviations which are explained just above the starting of the table. Moreover, each column of the table can be sorted by clicking on the header of that column. Clicking once will display the results in descending order while clicking twice will display in ascending order. For example, if a user wants to get peptide sequences having maximum length (column 'Len') then he/she needs to sort 'Len' column by cliking on 'Len' header. User may get detailed information about a peptide by clicking its ID (left column labeled S-ID).

Search results of property wise browsing (Polar residues between 0-25%)

S-ID: SATPdb ID; Seq: Sequence; Len: Length; HR: (%)Hydrophobic Residues; PR: (%)Polar Residues; Pos:(%) Positive Residues; Neg:(%) Negative Residues; SS:(%) Small size Residues;

The total number of entries retured by search is 2686

S-ID	Sequence	Len	HR	PR	Pos	Neg	SS
satpdb12385	AVV	3	100	0	0	0	33
satpdb12387	AVVPPLRCKAVFC	13	69	15	15	0	46
satpdb12404	ILGPVLGLVSDTLDDVLGIL	20	60	25	0	15	30
satpdb12420	ILGPVLGLVGNALGGLIKKL	20	60	15	10	0	35
satpdb12426	FFPIIAGMAAKVICAITKKC	20	60	20	15	0	45
satpdb12428	ILGPVLGLVGNALGGLIKKL	20	60	15	10	0	35
satpdb12429	GLFAVIKKVAAVIKKL	16	69	25	25	0	25
satpdb12434	FFPLLFGALSSLLPKLF	17	76	18	6	0	35
satpdb12441	LEAIPCSIPPCVFFNKPFVF	20	70	20	5	5	40
satpdb12446	ACSKKWEYUIVPILGFVYCCPGLIUGPFVC V	31	58	19	6	3	39
satpdb12459	LGG	3	33	0	0	0	67
satpdb12471	KLKLLLLL	8	75	25	25	0	0
satpdb12477	APP	3	100	0	0	0	100
satpdb12484	GG	2	0	0	0	0	100
satpdb12492	FFF	3	100	0	0	0	0
satpdb12520	GIFLKVLGVGKKVLCGVSGLC	21	48	19	14	0	38
satpdb12521	RGNVTLLCDCPNGPWVWVPA	20	55	25	5	5	45
satpdb12529	GLLTNVLGFLKKAGKGVLSGLLPL	24	54	25	13	0	38
satpdb12530	GAKPCGGFF	9	44	11	11	0	67
satpdb12532	FFGVRCVSP	9	56	22	11	0	44
satpdb12534	IEFFA	5	80	20	0	20	20
satpdb12545	LLGMIPLAISAISALSKL	18	67	22	6	0	44
satpdb12554	FLPFLAGLAANFLPKLFCKITRKC	24	63	25	17	0	38
satpdb12555	CRFCCRCCPRMRGCGLCCRF	20	20	25	25	0	55
satpdb12560	GVGY	4	50	25	0	0	50
satpdb12573	DCCPLPACPFGCNPCCGWPALLSGPHQVMN NE	32	47	25	0	6	56
satpdb12600	FLPLIGKILGTIL	13	69	15	8	0	31
satpdb12601	FITGLIGGLMKAL	13	54	15	8	0	38
satpdb12606	FLPLIAGVAASILPKIFCFITKKC	24	67	21	13	0	42
satpdb12608	LIAPFIRDYCCPRGPCMVWC	20	55	20	10	5	45
satpdb12609	IIGPVLGLVGSALGGLLKKI	20	60	15	10	0	40
satpdb12612	LAAIPMSIPPEVKFNKPFVF	20	70	25	10	5	35
satpdb12615	ILPWKWPWAPARR	13	77	23	23	0	38
satpdb12628	ILPILGNLLNGLL	13	69	15	0	0	23
satpdb12630	GLLSGVLGVGEKIVCGLSGLC	21	43	19	5	5	48
satpdb12631	GE(Gla)(Gla)VAKMA(Gla)ERE(Gla) EAGRLDLSKFP	41	39	24	10	12	37
satpdb12644	FLPALIGIAAKALPSLLCKITKKC	24	63	25	17	0	46
satpdb12649	VV	2	100	0	0	0	0
satpdb12650	FLPLIGGILAKLL	13	77	8	8	0	31
satpdb12651	IAP	3	100	0	0	0	67
satpdb12670	FIGTALGIASAIPAIVKLFK	20	70	20	10	0	45
satpdb12681	FFPIVGKLLFGLSGLL	16	69	13	6	0	31
satpdb12683	DECCAIPLCAKIFPGRCP	18	50	22	11	11	56
satpdb12690	VYPFPG	6	83	17	0	0	50
satpdb12693	FLPLIGRVLSGIL	13	69	15	8	0	31
satpdb12699	FLPAIAGMAAKFLPKIFCAISKKC	24	63	21	17	0	46
satpdb12701	AAVALLPAVLLALLAPVQRKRQKLMP	26	73	23	15	0	35
satpdb12702	YSSKDCLKDIGKGIGAGTVAGAAGGGLAAG LGAIPGAFVGAHFGVIGG	48	50	21	6	4	60
satpdb12713	OOWW	4	50	0	0	0	0
satpdb12714	GE(Gla)(Gla)LQ(Gla)NQ(Gla)LIR( Gla)KSN	37	35	22	5	3	32

entries from 351 - 400