Output of option Peptide Property of Browse Menu

This page list peptide entries having specific physico-chemical properties as selected by the user. The header of the table has abbreviations which are explained just above the starting of the table. Moreover, each column of the table can be sorted by clicking on the header of that column. Clicking once will display the results in descending order while clicking twice will display in ascending order. For example, if a user wants to get peptide sequences having maximum length (column 'Len') then he/she needs to sort 'Len' column by cliking on 'Len' header. User may get detailed information about a peptide by clicking its ID (left column labeled S-ID).

Search results of property wise browsing (Hydrophobic residues between 51-75%)

S-ID: SATPdb ID; Seq: Sequence; Len: Length; HR: (%)Hydrophobic Residues; PR: (%)Polar Residues; Pos:(%) Positive Residues; Neg:(%) Negative Residues; SS:(%) Small size Residues;

The total number of entries retured by search is 5622

S-ID	Sequence	Len	HR	PR	Pos	Neg	SS
satpdb28107	GWGSFFKKAAHVGKHVGKAALT	22	55	36	18	0	45
satpdb28111	VIGSILGALASGLPTLISWIKNR	23	57	30	9	0	43
satpdb28113	IVIYQYMDDLYVGSD	15	53	53	0	20	13
satpdb28119	AARPPLGCKAAFC	13	62	15	15	0	69
satpdb28122	FLPIIGKLLSGLL	13	69	15	8	0	31
satpdb28123	ILGEIWKGIKDIL	13	54	31	15	15	15
satpdb28128	GELGRPVYVLGDPGYYATHCIYATTNDALI FSV	33	58	42	3	9	42
satpdb28130	WPVVIRTVVAGYNLYRAIKKK	21	62	43	24	0	24
satpdb28131	GVVDILKGAGKDLLAHALSKLSEKV	25	52	40	16	12	32
satpdb28134	VEY	3	67	67	0	33	0
satpdb28135	ESTHPRISSEVHIPL	15	53	60	7	13	40
satpdb28138	GIGGVLLSAGKAALKGLAKVLAEKYAN	27	56	30	15	4	44
satpdb28141	GPPYQPLVPR	10	70	30	10	0	50
satpdb28147	GLFKVIKKVASVIGGL	16	56	25	19	0	31
satpdb28148	YARAARRAARR	11	55	55	45	0	45
satpdb28150	RPLA	4	75	25	25	0	50
satpdb28153	VKLKVyPLKVkLyP	14	71	43	29	0	14
satpdb28156	RRRFPWVCWPFLRRR	15	53	40	40	0	20
satpdb28159	LKLNSIVSWAKKVL	14	57	43	21	0	21
satpdb28160	FLAKNVAKKLVSHVAKKQLE	20	55	50	25	5	20
satpdb28161	KKLfkkilkyl	11	55	55	45	0	0
satpdb28162	FPPPGESAVDMSFFYALSNP	20	60	35	0	10	50
satpdb28163	GIGAVLKVLALISWIKRKR	19	58	32	26	0	26
satpdb28164	HCIYATTNDALIFSV	15	60	47	0	7	40
satpdb28167	VSALK	5	60	40	20	0	40
satpdb28175	VRLRIRVAVRRA	12	58	42	42	0	17
satpdb28183	LLPIVGNLLKSLL	13	69	23	8	0	23
satpdb28185	KWKIFKKIEKVGRNIRNGIIKAGPAVAVLG EAKAL	35	51	37	26	6	29
satpdb28189	DWEYHAHPKPNSFWT	15	60	60	7	13	33
satpdb28193	AMWKDVLKKIGTVALHAGKAALGAVADTIS Q	31	55	35	13	6	42
satpdb28195	L-hPhe	6	67	50	0	17	17
satpdb28198	GCKKWFKKAAHVGKNVGKVALNAYL	25	52	40	24	0	32
satpdb28203	GIGAAILSAGKSIIKGLANGLAEHF	25	56	28	8	4	48
satpdb28205	VYPFPGPIPNSL	12	75	25	0	0	50
satpdb28219	HFLkTLVNLAKKIL	14	64	43	21	0	14
satpdb28225	FLGALFGAAAKIVPSLICKISGKC	24	58	21	13	0	50
satpdb28234	FLPVIASVAAKVLPKVFCFITKKC	24	67	25	17	0	38
satpdb28235	RAGLKFPVGRVHRLLR	16	56	38	31	0	25
satpdb28238	MDVNPTLLFLKV	12	58	33	8	8	17
satpdb28242	IVVE	4	75	25	0	25	0
satpdb28243	LLIILRARIRKQAHAHSK	18	61	50	28	0	22
satpdb28244	PLASRPM	7	57	29	14	0	57
satpdb28248	LGRVDIHVWDGVYIRGR	17	53	41	18	12	18
satpdb28250	HLCW	4	75	25	0	0	25
satpdb28251	FFRLLFHGVHHVGKIKPRA	19	68	37	21	0	21
satpdb28254	AVNPIR	6	67	33	17	0	33
satpdb28258	FTY	3	67	67	0	0	33
satpdb28260	KALAKALAKLWKALAKAA	18	72	28	28	0	44
satpdb28264	VSAFK	5	60	40	20	0	40
satpdb28265	GVSLPEW	7	57	29	0	14	43

entries from 5301 - 5350