Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID827 | VNPFRPGDSEPPPAPGAQRAQ | Zyxin | Plasma | 730.03 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID828 | SPVTPKFTPVAS | Zyxin | Plasma | 615.83 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID829 | TQPRGPPASSPAPAPKF | Zyxin | Plasma | 569.3 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID2000 | VNPFRPGDSEPPPAPGAQRAQ | Zyxin | Serum | 2187.08211 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2001 | NTQPRGPPASSPAPAPKFSPVTPKFTPVAS | Zyxin | Serum | 3030.5927 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2002 | GPPASSPAPAPKFSPVTPKFTPVAS | Zyxin | Serum | 2434.28965 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2003 | LANTQPRGPPASSPAPAPKFSPVTPKFTPVAS | Zyxin | Serum | 3214.71388 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2004 | VSLANTQPRGPPASSPAPAPKFSPVTPKFTPVAS | Zyxin | Serum | 3400.81433 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2005 | KFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTY | Zyxin | Serum | 3737.8074 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2006 | VNPFRPGDSEPPPAPGAQ | Zyxin | Serum | 1831.88531 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2007 | TQPRGPPASSPAPAPKF | Zyxin | Serum | 1704.89475 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2008 | VNPFRPGDSEPPPAPGA | Zyxin | Serum | 1703.82673 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2009 | EEIFPSPPPPPEEEGGPEAPIPPPPQPREKVS | Zyxin | Serum | 3426.69835 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2010 | HVQPQPQPKPQVQLH | Zyxin | Serum | 1759.94819 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2011 | GAPGPLTLKEVEELE | Zyxin | Serum | 1580.82975 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2012 | HVQPQPQPKPQVQLHVQSQT | Zyxin | Serum | 2303.21346 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2013 | FSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTY | Zyxin | Serum | 3609.71244 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2014 | KFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQ | Zyxin | Serum | 4064.96167 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID9917 | PGPLTLKEVEELEQ | Zyxin | Serum | 791.43 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID12992 | FPLDGHVL | Zyxin | Plasma | 897.483 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |