Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
---|---|---|---|---|---|---|---|---|
CancerPDF_ID11054 | SSYSKQFTSSTSYNRGDST | Fibrinogen alpha chain | Serum | 2102.7 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Upregulated in ESCC patients vs control with mean intensity in cancer as 532.28 and mean intensity in control as 266.24 | 26993605 |
CancerPDF_ID11056 | SYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Serum | 3239.9 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Upregulated in ESCC patients vs control with mean intensity in cancer as 831.12 and mean intensity in control as 100.55 | 26993605 |