| Primary information |
|---|
| CancerPDF_ID | CancerPDF_ID11056 |
| PMID | 26993605 |
| Peptide Sequence | SYKMADEAGSEADHEGTHSTKRGHAKSRPV |
| Peptide Sequence in Publication | K.SYKMADEAGSEADHEGTHSTKRGHAKSRPV.R |
| Protein Name | Fibrinogen alpha chain |
| UniprotKB Entry Name | "FIBA_HUMAN," |
| Biofluid | Serum |
| M/Z | 3239.9 |
| Charge | NA |
| Mass/H+ | NA |
| Mass (in Daltons) | NA |
| Profiling Technique | MALDI-TOF |
| Peptide Identification Technique | LTQ-Orbitrap-MS/MS |
| Quantification Technique | NA |
| Labeling | Label Free |
| FDR | less than 0.000006 |
| p-Value | less than 0.05 |
| Software | SEQUEST |
| Length of Peptide | 30 |
| Cancer Type | Esophageal squamous cell carcinoma (ESCC) |
| Database for Peptide search | IPI Human Database (3.45) |
| Modification | NA |
| Number of Patients | for training 100 ESCC patients and 98 healthy individuals were used and for validation 101 ESCC patients and 98 healthy individuals were used |
| Regulation/Differential Expression | Upregulated in ESCC patients vs control with mean intensity in cancer as 831.12 and mean intensity in control as 100.55 |
| Validation | external cross validation done |
| Sensitivity | 97% on training dataset and 97.3 on validation dataset |
| Specificity | 95.92% on training dataset and 100% on validation dataset |
| Accuracy | NA |
| Secondary information |
|---|
| Peptide Atlas | NA |
| IEDB | |