Primary information |
---|
CancerPDF_ID | CancerPDF_ID11056 |
PMID | 26993605 |
Peptide Sequence | SYKMADEAGSEADHEGTHSTKRGHAKSRPV |
Peptide Sequence in Publication | K.SYKMADEAGSEADHEGTHSTKRGHAKSRPV.R |
Protein Name | Fibrinogen alpha chain |
UniprotKB Entry Name | "FIBA_HUMAN," |
Biofluid | Serum |
M/Z | 3239.9 |
Charge | NA |
Mass/H+ | NA |
Mass (in Daltons) | NA |
Profiling Technique | MALDI-TOF |
Peptide Identification Technique | LTQ-Orbitrap-MS/MS |
Quantification Technique | NA |
Labeling | Label Free |
FDR | less than 0.000006 |
p-Value | less than 0.05 |
Software | SEQUEST |
Length of Peptide | 30 |
Cancer Type | Esophageal squamous cell carcinoma (ESCC) |
Database for Peptide search | IPI Human Database (3.45) |
Modification | NA |
Number of Patients | for training 100 ESCC patients and 98 healthy individuals were used and for validation 101 ESCC patients and 98 healthy individuals were used |
Regulation/Differential Expression | Upregulated in ESCC patients vs control with mean intensity in cancer as 831.12 and mean intensity in control as 100.55 |
Validation | external cross validation done |
Sensitivity | 97% on training dataset and 97.3 on validation dataset |
Specificity | 95.92% on training dataset and 100% on validation dataset |
Accuracy | NA |
Secondary information |
---|
Peptide Atlas | NA |
IEDB | |