Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID11033 | KEDIDTSSKGGCVQ | RNA-binding protein 6 | Serum | 1466.98 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11034 | AILVDLEPGTMDSVR | tubulin beta chain | Serum | 1618.22 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11035 | IHTGENPYECSECGKAFRYSSALVRHQRIHTGEKPLNGIGMSKSSLRVTTELN | zinc finger protein 3 | Serum | 5905.23 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11036 | NA | NA | Serum | 1866.63 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11037 | NA | NA | Serum | 3317 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11038 | NA | NA | Serum | 6433.36 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11039 | NA | NA | Serum | 1780.1 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11040 | NA | NA | Serum | 1061.34 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11041 | NA | NA | Serum | 5752.25 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11042 | NA | NA | Serum | 5724.76 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11043 | NA | NA | Serum | 5844.36 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11044 | NA | NA | Serum | 5739.69 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11045 | NA | NA | Serum | 5818.83 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11046 | NA | NA | Serum | 4091.86 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11047 | NA | NA | Serum | 1714.57 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11048 | NA | NA | Serum | 1981.69 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11049 | NA | NA | Serum | 1077.14 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11050 | NA | NA | Serum | 1547 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11074 | NA | C1RL_HUMAN | Urine | 1023.889 | MALDI-TOF | Clear cell renal carcinoma | NA | 26482227 |
| CancerPDF_ID11075 | NA | PTGDS_HUMAN | Urine | 1525 | MALDI-TOF | Clear cell renal carcinoma | NA | 26482227 |
| CancerPDF_ID11076 | NA | A1AG1_HUMAN | Urine | 1755.759 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated with increse in tumor mass,primary tumor stage" | 26482227 |
| CancerPDF_ID11077 | NA | A1AG2_HUMAN | Urine | 1755.759 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated with increse in tumor mass,primary tumor stage" | 26482227 |
| CancerPDF_ID11078 | NA | ZA2G_HUMAN | Urine | 1825.638 | MALDI-TOF | Clear cell renal carcinoma | "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" | 26482227 |
| CancerPDF_ID11079 | NA | PGBM_HUMAN | Urine | 1825.638 | MALDI-TOF | Clear cell renal carcinoma | "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" | 26482227 |
| CancerPDF_ID11080 | NA | UROM_HUMAN | Urine | 1912.106 | MALDI-TOF | Clear cell renal carcinoma | Downregulated with increse in tumor mass | 26482227 |
| CancerPDF_ID11081 | NA | MMP23_HUMAN | Urine | 1934.197 | MALDI-TOF | Clear cell renal carcinoma | Downregulated with increse in tumor mass | 26482227 |
| CancerPDF_ID11082 | NA | MYH1_HUMAN | Urine | 1934.197 | MALDI-TOF | Clear cell renal carcinoma | Downregulated with increse in tumor mass | 26482227 |
| CancerPDF_ID11083 | NA | MYH4_HUMAN | Urine | 1934.197 | MALDI-TOF | Clear cell renal carcinoma | "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" | 26482227 |
| CancerPDF_ID11084 | NA | GP162_HUMAN | Urine | 2192.065 | MALDI-TOF | Clear cell renal carcinoma | "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" | 26482227 |
| CancerPDF_ID11085 | NA | KPB1_HUMAN | Urine | 2192.065 | MALDI-TOF | Clear cell renal carcinoma | "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" | 26482227 |
| CancerPDF_ID11086 | NA | FIBA_HUMAN | Urine | 2660.82 | MALDI-TOF | Clear cell renal carcinoma | Upregulated with increse in tumor mass | 26482227 |
| CancerPDF_ID11087 | NA | HBA_HUMAN | Urine | 2790.7 | MALDI-TOF | Clear cell renal carcinoma | "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" | 26482227 |
| CancerPDF_ID11088 | NA | ADA19_HUMAN | Urine | 3151.096 | MALDI-TOF | Clear cell renal carcinoma | "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" | 26482227 |
| CancerPDF_ID11089 | NA | RSPH3_HUMAN | Urine | 3151.096 | MALDI-TOF | Clear cell renal carcinoma | "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" | 26482227 |
| CancerPDF_ID11090 | NA | DREB_HUMAN | Urine | 3571.126 | MALDI-TOF | Clear cell renal carcinoma | "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" | 26482227 |
| CancerPDF_ID11091 | NA | G3P_HUMAN | Urine | 3723.84 | MALDI-TOF | Clear cell renal carcinoma | Downregulated with increse in tumor mass | 26482227 |
| CancerPDF_ID11092 | NA | NOTC2_HUMAN | Urine | 4026.883 | MALDI-TOF | Clear cell renal carcinoma | "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" | 26482227 |
| CancerPDF_ID11093 | NA | SAFB2_HUMAN | Urine | 4355.12 | MALDI-TOF | Clear cell renal carcinoma | "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" | 26482227 |
| CancerPDF_ID11094 | NA | CC168_HUMAN | Urine | 4626.92 | MALDI-TOF | Clear cell renal carcinoma | "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" | 26482227 |
| CancerPDF_ID11095 | NA | PTGDS_HUMAN | Urine | 1525 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in pT1b compared to pT1a patients | 26482227 |
| CancerPDF_ID11096 | NA | A1AG1_HUMAN | Urine | 1755.8 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in pT1b compared to pT1a patients | 26482227 |
| CancerPDF_ID11097 | NA | A1AG2_HUMAN | Urine | 1755.8 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in pT1b compared to pT1a patients | 26482227 |
| CancerPDF_ID11098 | NA | GP162_HUMAN | Urine | 2192.1 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in pT1b compared to pT1a patients | 26482227 |
| CancerPDF_ID11099 | NA | KPB1_HUMAN | Urine | 2192.1 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in pT1b compared to pT1a patients | 26482227 |
| CancerPDF_ID11100 | NA | HBA_HUMAN | Urine | 2790.7 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in pT1b compared to pT1a patients | 26482227 |
| CancerPDF_ID11101 | NA | SAFB2_HUMAN | Urine | 4355.1 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in pT1b compared to pT1a patients | 26482227 |
| CancerPDF_ID11102 | NA | CC168_HUMAN | Urine | 4626.9 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in pT1b compared to pT1a patients | 26482227 |
| CancerPDF_ID11103 | NA | NA | Urine | 1219.1 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in pT1b compared to pT1a patients | 26482227 |
| CancerPDF_ID11104 | NA | NA | Urine | 2282.1 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in pT1b compared to pT1a patients | 26482227 |
| CancerPDF_ID11105 | NA | NA | Urine | 4366.9 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in pT1b compared to pT1a patients | 26482227 |
| CancerPDF_ID11106 | NA | NA | Urine | 4439.1 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in pT1b compared to pT1a patients | 26482227 |
| CancerPDF_ID11107 | NA | NA | Urine | 4751.5 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in pT1b compared to pT1a patients | 26482227 |
| CancerPDF_ID11108 | NA | NA | Urine | 5514.2 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in pT1b compared to pT1a patients | 26482227 |
| CancerPDF_ID11109 | NA | NA | Urine | 6237.8 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in pT1b compared to pT1a patients | 26482227 |
| CancerPDF_ID11110 | NA | NA | Urine | 1023.9 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in grade vs normal | 26482227 |
| CancerPDF_ID11111 | NA | NA | Urine | 1194.2 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in grade vs normal | 26482227 |
| CancerPDF_ID11112 | NA | NA | Urine | 1825.6 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in grade vs normal | 26482227 |
| CancerPDF_ID11113 | NA | NA | Urine | 3723.8 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in grade vs normal | 26482227 |
| CancerPDF_ID11114 | NA | NA | Urine | 3571.1 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in grade vs normal | 26482227 |
| CancerPDF_ID11115 | NA | NA | Urine | 4355.1 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in grade vs normal | 26482227 |
| CancerPDF_ID11116 | NA | NA | Urine | 4751.5 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in grade vs normal | 26482227 |
| CancerPDF_ID11117 | NA | NA | Urine | 5004.4 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in grade vs normal | 26482227 |
| CancerPDF_ID11118 | NA | NA | Urine | 5027.8 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in grade vs normal | 26482227 |
| CancerPDF_ID11119 | NA | NA | Urine | 5043.6 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in grade vs normal | 26482227 |
| CancerPDF_ID11120 | NA | NA | Urine | 5231.5 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in grade vs normal | 26482227 |
| CancerPDF_ID11121 | NA | NA | Urine | 1755.8 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID11122 | NA | NA | Urine | 1894.3 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID11123 | NA | NA | Urine | 1912.1 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID11124 | NA | NA | Urine | 1934.2 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID11125 | NA | NA | Urine | 2660.8 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID11126 | NA | NA | Urine | 2961.1 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID11127 | NA | NA | Urine | 4026.9 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID11128 | NA | NA | Urine | 4638.5 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID11129 | NA | NA | Urine | 4751.5 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID11130 | NA | NA | Urine | 4962.8 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID11131 | NA | NA | Urine | 5231.5 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID11132 | NA | NA | Urine | 5578.2 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID11133 | NA | NA | Urine | 6261.4 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID11134 | NA | NA | Urine | 6305.2 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID11135 | NA | NA | Urine | 8181.9 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |