| Primary information |
|---|
| sequence ID | Seq_3744 |
| Peptide sequence | IHTGENPYECSECGKAFRYSSALVRHQRIHTGEKPLNGIGMSKSSLRVTTELN |
| CancerPDF_ID | CancerPDF_ID11035, |
| PMID | 25368985 |
| Protein Name | zinc finger protein 3 |
| UniprotKB Entry Name | MORC3_HUMAN |
| Fluid | Serum |
| M/Z | 5905.23 |
| Profiling Technique | MALDI-TOF |
| Peptide Identification technique | MALDI time-of-flight (TOF) mass spectrometry MS |
| Labelled/Label Free | Label Free |
| CancerPDF_ID | CancerPDF_ID11035, |
| p-Value | less than 0.001 |
| Software | ClinProTools |
| Length | 53 |
| Cancer Type | Clear cell renal carcinoma |
| Database | Mascot database |
| Modification | NA |
| Number of Patients | "58 serum samples from ccRCC patients, 40 from additional paired pre- and post-operative ccRCC patients (n = 20), and 64 from healthy volunteers as healthy control" |
| Regulation | "Upregulated in ccRCC, preoperative and post operative patients vs control" |
| Validation | NA |
| Sensitivity | 0.8838 |
| Specificity | 0.9167 |
| Accuracy | NA |
| Peptide Atlas | NA |
| IEDB | NA |