Primary information |
---|
sequence ID | Seq_3744 |
Peptide sequence | IHTGENPYECSECGKAFRYSSALVRHQRIHTGEKPLNGIGMSKSSLRVTTELN |
CancerPDF_ID | CancerPDF_ID11035, |
PMID | 25368985 |
Protein Name | zinc finger protein 3 |
UniprotKB Entry Name | MORC3_HUMAN |
Fluid | Serum |
M/Z | 5905.23 |
Profiling Technique | MALDI-TOF |
Peptide Identification technique | MALDI time-of-flight (TOF) mass spectrometry MS |
Labelled/Label Free | Label Free |
CancerPDF_ID | CancerPDF_ID11035, |
p-Value | less than 0.001 |
Software | ClinProTools |
Length | 53 |
Cancer Type | Clear cell renal carcinoma |
Database | Mascot database |
Modification | NA |
Number of Patients | "58 serum samples from ccRCC patients, 40 from additional paired pre- and post-operative ccRCC patients (n = 20), and 64 from healthy volunteers as healthy control" |
Regulation | "Upregulated in ccRCC, preoperative and post operative patients vs control" |
Validation | NA |
Sensitivity | 0.8838 |
Specificity | 0.9167 |
Accuracy | NA |
Peptide Atlas | NA |
IEDB | NA |