Primary information |
---|
CancerPDF_ID | CancerPDF_ID11091 |
PMID | 26482227 |
Peptide Sequence | NA |
Peptide Sequence in Publication | STHGKFHGTVKAENGKLVINGNPITIFQERDPSK |
Protein Name | G3P_HUMAN |
UniprotKB Entry Name | G3P_HUMAN |
Biofluid | Urine |
M/Z | 3723.84 |
Charge | NA |
Mass/H+ | NA |
Mass (in Daltons) | NA |
Profiling Technique | MALDI-TOF |
Peptide Identification Technique | LC-ESI-MS/MS |
Quantification Technique | NA |
Labeling | Label Free |
FDR | FDR less than 5 % |
p-Value | NA |
Software | MASCOT |
Length of Peptide | NA |
Cancer Type | Clear cell renal carcinoma |
Database for Peptide search | SwissProt Database |
Modification | NA |
Number of Patients | "117 clear cell RCC patients (ccRCC) (72 men, 45 women)" |
Regulation/Differential Expression | Downregulated with increse in tumor mass |
Validation | external cross validation not done |
Sensitivity | NA |
Specificity | NA |
Accuracy | NA |
Secondary information |
---|
Peptide Atlas | NA |
IEDB | |